CAZyme Information: MGYG000000355_00358

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000000355_00358
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	MGYG000000355_5|CGC2	65932.34	5.6649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000355	2806154	MAG	Sweden	Europe

• Gene Location: Start: 59925; End: 61676 Strand: +

Full Sequence      

MKNSLLTILASLCILPLSAQQRDIRVREYITPKRIVWMQDSAQIRNAEYLLDEGNGQADL
SNARICLIRSTQDKHPALLFDFGKEIQGGLQFVTGMPASHEPVRIRVRLGESASEAMCEI
DGKNGATNDHAMRDFYHQLPWLGVSEVGNSGFRFVRIDLPDDSVELQLKEIRAISVFQDI
PYRGSFKSNDERLNRIWQTGAYTVHLNMQEFLIEGAKRDRLVWIGDFHPEVMAVNSVFGY
NPIIAKSLDLSRDITPLPNWMNGISSYSIWWLLIQQDWYRYQGNLEYLKAQKPYLTDLLR
LFISKVDDEGREHLDGNRFLDWPSSANPEAIDAGLQALMVRAMIAGQELCAILDEPELME
ACRQTESKLRKAAPKVIRPFLKLKKSPTEPGMKQAAALLAWAGLMEPEKADKEYLSVEGG
RGVSTFYGYYMLRSLALAGNYQSALDIIRSYWGGMLDMGATTFWEDFNLDWLPNAAPIDE
LVPAGKKDIHGDFGAYCYKGFRHSLCHGWASGPTSWLSEYVLGIQVVEPGMKVVRVDPHL
GDLDWVEGTFPTPFGEIKVRHERQEDGSVRSEIHAPEGVKIVK

Enzyme Prediction     

No EC number prediction in MGYG000000355_00358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	76	580	6.1e-99	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17390	Bac_rhamnosid_C	1.85e-09	523	580	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17389	Bac_rhamnosid6H	2.44e-08	184	473	4	318	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48045.1	5.74e-315	17	583	16	583
QUT54421.1	3.63e-304	1	581	1	580
QUT95156.1	5.15e-304	1	581	1	580
AST53793.1	5.15e-304	1	581	1	580
QJE27358.1	7.05e-304	1	581	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.09e-45	68	559	184	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	3.16e-17	77	522	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000398	0.997778	0.001248	0.000216	0.000188	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000355_00358.