CAZyme Information: MGYG000000355_00460

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000000355_00460
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554	MGYG000000355_7|CGC2	64783	9.3008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000355	2806154	MAG	Sweden	Europe

• Gene Location: Start: 50620; End: 52284 Strand: -

Full Sequence      

MINQAERNPVRQWLFLVIVFCCAFFVNNKAIFVDIMESRNLITAREMVYDGNWLTPTMNG
ELRLEKPPLPTWIAAAVEWVSPDNIGLQRAVAGMAAVLLAVFLYLLAVRLTRDRLYAFIA
VLLLCTSYSIVLMGRTASWDIYCHAFMIVAIYYLYKALQASTCRWSWFTIAGVMMGLSFL
GKGPVSFYALLLPFLCAYGLYYKVNLTDKWKGGLWMLFLTLLISSWWYVYIYVSHPEMME
YVLKKESGSWMNYNVRPWWYYWKFFLETGAWSLLTLTALLVPVWRKRLADPKPYYFVLVW
MLFVLFFLSLIPEKKSRYLLPVVIPAVLTGAHLFVYWIEQMKVDDRLGRLLYRMNAGLIL
LVTCALPFLLYRYVYSEMHMGLGAYLFLSLLCIGIGVGVFYAFRKVRPYTFLLGVVGLMM
IAELFMMPYIGSFVTNKERKSISLTRDIKALKPLPFYQDSRDTLRIELVYAAYKKILKID
LSDTLQVRRSLPFVLVSKEKAEEVLPEYVLDKVELTPIDRYNDNPWPKGHRRYTEDFINY
VTVIREKKDDEQDE

Enzyme Prediction     

No EC number prediction in MGYG000000355_00460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	428	7.3e-65	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.36e-31	10	428	6	426	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.43e-17	44	371	40	365	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.50e-10	66	226	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	7.47e-10	36	235	31	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	2.97e-05	51	179	76	206	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSV47361.1	3.39e-18	11	321	6	314
ABA88522.1	5.29e-17	37	322	58	343
AAR35928.2	5.87e-17	7	321	2	315
ADI85313.1	5.87e-17	7	321	2	315
AJY68843.1	5.87e-17	7	321	2	315

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.76e-16	37	321	30	308	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A6V1N8	8.50e-16	8	377	2	373	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
Q4ZSZ0	1.13e-15	37	340	34	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q48HY9	1.90e-15	37	369	33	356	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=arnT PE=3 SV=1
B4ETL9	1.44e-14	3	321	4	323	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.940381	0.056228	0.001338	0.000417	0.000269	0.001387

TMHMM  Annotations     

start	end
13	35
86	108
115	137
141	158
170	192
212	234
262	284
294	311
318	337
352	374
381	403
413	435