CAZyme Information: MGYG000000355_00857

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000000355_00857
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36863.55	8.5098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000355	2806154	MAG	Sweden	Europe

• Gene Location: Start: 37891; End: 38853 Strand: +

Full Sequence      

MRNKLVTGIAFLALVGVACVSLCSKDSTQVLREKPVVPSMIMTPEIPERIYFCGEVLDLT
RYNMHEGIDRELTSFSYLHATTMLTLKRANRYFPVIEPILEQYGIPDDFKYLAVIESHLD
PRVKSPARAVGMWQFLESTGREFGLTITPTVDERSHVEKSTIAACKYLKKAYERYGDWAA
VASSYNAGMGRISGELNKQDVDSSFDLWLVEETTRYIYRILAIKLIFENPYKYGFVLRAR
DLYKPIACKEVEVSANIPDLASFAKKHGITYADLKRFNPWLRDRKLVTNGKKFLLQIPDT
ADLYYRSPNEYVYNRNWIVE

Enzyme Prediction     

No EC number prediction in MGYG000000355_00857.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	92	224	1.8e-21	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.84e-57	100	224	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	7.29e-26	76	295	92	309	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	4.13e-23	101	192	6	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	7.07e-15	101	192	6	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	9.43e-15	112	222	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47799.1	1.15e-164	3	320	8	325
AST53297.1	4.78e-162	18	319	23	324
QJE27969.1	4.78e-162	18	319	23	324
QIX66656.1	4.78e-162	18	319	23	324
QUT53912.1	4.78e-162	18	319	23	324

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.73e-26	64	302	77	313	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.73e-26	64	302	77	313	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000471	0.004464	0.995096	0.000003	0.000005	0.000004

TMHMM  Annotations     

start	end
5	24