CAZyme Information: MGYG000000355_01082

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000000355_01082
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516		59891.58	9.1422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000355	2806154	MAG	Sweden	Europe

• Gene Location: Start: 22642; End: 24192 Strand: +

Full Sequence      

MKYKWIFLFLFLTLLPLLSLRDYTVGNELRYLSIADEAMREGTFFAFTNHGVFYADKPPL
YFWIIMLGKWLFGEHYMWFISLFSFIPAGIITCIMDRWCAKELADSYRTTGVLMMMSCGL
FLALILILRMDMLMCMFITLALYIFYRMLKSEGNKQVNAVLFPLFIFLALFTKGPIGFLV
PLLSTFVFLLLTKRFRTIGKYWGWKTWTILLLCCAGWFGAAYAEGGQEYMHNMLFHQTID
RAVNSFRHDGPFYHYCLTIWYAMLPWSFLLASVLIISALKKPKYTELQKFFLTIIGTTFV
LLSSISSKVDVYMLPMFPFIVYLALMFLPEVSRNRWVMLSLVLPASIFVLAFPAYMVVSR
METMAFAIQPLFYVAAGLLSLTGILALYILYKKEQTLLAIRTLVYGLFVAAFIGSWDIPK
INGEIGYRELCTKAKELARIHQTSDYYVWKLRRPENMDVYLQQDIIITTPEAVAQSGDRQ
ALFLVPAKELSHLPDYFAEKETYQIGRRYAIIVLKD

Enzyme Prediction     

No EC number prediction in MGYG000000355_01082.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	475	8e-68	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.23e-20	27	417	34	431	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.46e-11	28	326	33	328	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	5.43e-08	56	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	4.44e-04	51	213	56	224	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH86812.1	2.09e-185	1	514	1	517
QTO25703.1	8.43e-185	1	514	1	517
QLK84536.1	8.43e-185	1	514	1	517
QUU03965.1	5.92e-180	1	514	1	517
QRP88934.1	3.38e-179	1	514	1	517

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.98e-19	12	471	7	445	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B7LM74	1.31e-10	27	274	31	279	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2
C5BDQ8	2.86e-09	27	317	31	321	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A6V1N8	2.01e-08	18	274	22	279	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
Q02R27	2.66e-08	18	274	22	279	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.217996	0.777658	0.002095	0.000660	0.000640	0.000936

TMHMM  Annotations     

start	end
5	24
76	98
119	141
166	188
201	223
256	278
290	307
311	329
336	358
368	390
397	419