CAZyme Information: MGYG000000355_01703

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000000355_01703
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000000355_45|CGC1	76956.76	4.7849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000355	2806154	MAG	Sweden	Europe

• Gene Location: Start: 18157; End: 20181 Strand: +

Full Sequence      

MNKLCILALAVSAFSCSSGTSDDEALMLDAIPTEKVNTNYVSNRDPLHPQRFIKLQTGSI
RPEGWIRTMLELQRDGLNGHLGEISAWLQKEDNAWLKSGGQWGWEEVPYWLRGYAGVAYL
LEDEKMLKETKTWIEAILSSQREDGNFGPYNENNGAQDFWPNMLALWILQSYYEYSSDER
VIDFMTRYFQYQLRVPDDKFLESYWENSRGGDNLWSVVWLYNRTGDKDLLKLAEKLHRNT
ANWTKSTELPNWHNVNIAQCFREPATYYLFNGDEKMLSASYNVQSLIRRAFGQVPGGMFG
ADENARMGFFDPRQGTETCGFAEQMASDEIMLLITGDPYWAENCEDVAFNSYPAALMPDM
KSLRYITSPNMVMSDSENHKPGIDNAGPFLAMNPFSSRCCQHNHGFAWPYYVEHLVMATP
DNGVAAVLFNSCDATVKVGEGETIILKERTDYPFDTHVSFSIECQNPVTFPFYIRVPSWT
KGAEVKINGKKVNANLEKGEYLCLHREWTNGDSIEANFPMEISYRKWQVNKNSVSVDYGP
LTLSLKIGEKYVKKNSTETAIWDSKWQKGADTENWPSYEIYPETPWNYALQVHSGVTLKE
HKKLTPGVNPFTTENVPLLFEAKGRLVPDWTLDEYKLCGVLPYENAAKSEQVDAIELVPM
GAMRLRISAFPTCD

Enzyme Prediction     

No EC number prediction in MGYG000000355_01703.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	216	543	4.9e-29	0.6302186878727635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.83e-109	65	544	16	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.99e-18	103	548	57	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGJ53184.1	3.86e-167	8	672	12	666
QKW18167.1	6.71e-167	40	672	51	669
QBR04944.1	4.31e-166	8	672	12	666
ALU92252.1	1.71e-165	39	672	43	666
QNQ38172.1	1.04e-163	39	672	43	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.72e-15	106	546	78	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.32e-13	106	546	78	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000313	0.186731	0.812705	0.000083	0.000097	0.000083

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000355_01703.