CAZyme Information: MGYG000000355_01768

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000000355_01768
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43156.91	9.0775

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000355	2806154	MAG	Sweden	Europe

• Gene Location: Start: 905; End: 2038 Strand: +

Full Sequence      

MKYYLIAGEASGDLHASNLMRALKAADAQADFRFLGGDLMQQVGGTLVKHYREMAFMGFI
PVLMNLRTILRNMELCKEDIRNYRPDVVILVDYPGFNLKIAQYVKTQLHLPVHYYISPKI
WAWKQYRIKAFRKYVDHIYSILPFEPAFFRKLNYEVDYVGNPSVDSVTAYRENHPIDRMS
FYRMNRLEEKPIIALLAGSRRQEIKDNLPVMLRVAARHPEYQAVIGGAPGIEPDYYAPYL
QGYDAHLVFGQTYPLLSHSRVALVTSGTATLETALFRVPQVVCYKVIGGKLANFVFEHFF
HTPYISLVNLIAGREVVQELFGARFSEEQIEAELSRILHDTDYRSAMLQGYDDIIRELGS
AGASARTASLIVKRIRP

Enzyme Prediction     

No EC number prediction in MGYG000000355_01768.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	1.5e-109	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.71e-104	1	376	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.24e-94	1	373	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.59e-72	4	344	2	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.19e-56	5	368	10	379	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.85e-43	1	371	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK92630.1	1.80e-200	1	375	1	375
QUR47916.1	1.80e-200	1	375	1	375
QIX64622.1	1.04e-199	1	375	1	375
ABR44355.1	1.48e-199	1	375	1	375
QRO15504.1	1.48e-199	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.62e-33	5	358	11	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.62e-33	5	358	11	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.24e-64	5	377	9	380	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	4.28e-60	5	376	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	6.55e-59	5	375	11	380	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q6ALW0	1.51e-57	5	375	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q3JAC1	6.05e-57	5	372	10	375	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000355_01768.