CAZyme Information: MGYG000000355_02186

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000000355_02186
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
973		108751.5	9.2261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000355	2806154	MAG	Sweden	Europe

• Gene Location: Start: 1186; End: 4107 Strand: -

Full Sequence      

MKKLVCILLICWLSASYLSARQMPALYRNVDQKAMNHWADSVFDSLSMDERIGQLFMIVA
DVKTSAQNVQKLKRYVREQKIGGVLFHKGNPADQAFLTNQMQAEARVPLFVSLDGEWGLS
MRLSGTTRFPKNMMLGAIENKLLIRKYGEEVARQCKEMGIHINFAPDLDVNSNEENPVIG
IRSFGENPHAVAEKGIAYSKGLEENGIISVAKHFPGHGDTSEDSHETLPAIYHNRERLDS
VELVPFREYIRQGFAGIMTGHLYIPALDKRKGRAASLSQAVVTELLQNELEFNGLCFTDA
LAMKGASPKKADNPCVQALLAGNDILLAPRAPISDFKAVKEAVQEGTIPMAYIESKCLKI
LKYKYIAGLHHYQPIKLKGLSERLNTGHAAWLAAKLNEEAITVLKNEGGILPIADLKRPK
IAVLTIGDAITDDFTETVSSYVHTDNYTITRSTSAARVQQIYNKLDNYDLILCAIHTVRI
PESAALRKLATQKKLVYTFFTIPYFCKSYKKSIAGAQAVVLAYEGTPLAQRYAAQVLFGG
VGAKGKLPVSIPDLYFSGAGIFTPKIRLGYHEAEEVGLNLERLEEIGRIAEEGIRARAYP
GCQLLVAKDGMIIYNRAFGKYDYEHRQPITNESVYDLASASKAAGTLLAVMEAYDRKAFR
LTDKIADYIPELKGSNKKNVTIKEMLFHQSGIVPTINFYTKAMEKGKFKPELVSFTPHPD
YPLKVAKDIYLKSSFQDSILQMIKKSKVRNKTYRYSCVNFILLKMMTENVLHRPMDQVLQ
DDFFQPLGAWHLTYNPLDKKIDSMLIAPTEYDKTVRHQLIRGYVHDEAAAFQGGVSGNAG
LFSNANDLAKVLQMLLNEGVYGKERYLSKETVRLFTQTKSPTCRRGLGFDKPSVGSKASP
CGALAPASVYGHTGFTGTCFWVDPDHQLIYIFLCNRIYPTRTNTKLSSLNIRTRIQDAIY
KSLTDYPAELHKD

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	327	5.5e-56	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.82e-72	46	425	1	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.33e-68	47	361	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	3.72e-60	571	936	28	395	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	8.51e-44	588	941	3	313	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	8.02e-40	573	942	28	369	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH98636.1	0.0	7	963	6	991
QUT21701.1	0.0	7	963	6	991
BBK92319.1	0.0	7	963	6	991
QJE31090.1	0.0	7	963	6	991
QCY58561.1	0.0	7	963	6	991

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	9.19e-64	45	551	10	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.19e-60	17	581	18	637	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	2.46e-60	14	587	19	647	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3LK6_A	6.44e-60	39	581	9	611	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
3SQL_A	8.93e-52	72	364	50	346	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	6.52e-60	17	581	18	637	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q8XBJ0	9.28e-49	574	936	31	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=yfeW PE=3 SV=1
P77619	9.28e-49	574	936	31	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2
P48823	1.03e-48	71	415	54	427	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q8ZN80	5.96e-43	574	947	31	406	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000699	0.998299	0.000419	0.000172	0.000185	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000355_02186.