CAZyme Information: MGYG000000356_02611

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; VUNI01
• CAZyme ID: MGYG000000356_02611
• CAZy Family: GH31
• CAZyme Description: Oligosaccharide 4-alpha-D-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754	MGYG000000356_45|CGC1	87738.84	4.7196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000356	2991584	MAG	Sweden	Europe

• Gene Location: Start: 2629; End: 4893 Strand: +

Full Sequence      

MNFGKKLSYEQTDNRLRIHFENQDVILEFIRDDIVRVLVPFWMEDYRSQAIEGDKSVPVD
YSVEEFQNVVIIRTDRLTIKIEDEFYMEVYDEKNHLLMADYRGDRMEKEAMDQQMIDLLA
AEGHDVSKINQNSYAVQTAKALDPEDCFYGLGDKSGFLNKRHYEYENWNSDLPQAHTEDF
HALYKSIPFLICLRKDCVYGLFFDNTFHSYMNLGKESDSYFYYAADDGNLDYYILGGDTM
ADVIGNYTYLTGRTPLPQLWALGYQQSRWGYMSADDIMEVAKKYRDLRIPCDVIHLDIDY
MDHFKVFTWNEKDYGKKGELFASMKQLGYKPVTIIDPGTKKEQGYFMYEEGVSREYFAKD
ANGKIYVNEVWPGESVYPDFGRKEVRDWWAGHHKELLDMGAQGIWNDMNEPASFRGELPL
DVRFHDEKRETTHAEIHNVYGHNMSKAAFEGIREATGKRPFVITRACYAGTQKYSTVWTG
DNQSLWSHLQMMIPQLCNLGMSGFTFCGADVGGFGADCTPELLCRWVEAACFSPLFRNHS
SKGSKRQEPWQFDEEVVNINRKYIELRYRFLPYIYDLFYQEQQTGLPVMRPLVLHYADDP
EVRNLNTEFLVGEQMLVAPVLEQGATRRMVYLPEGVWYDYWTGEMIQGKQYILRDAPIEV
CPIYLKAGSIIPTYQVSQYVGEKAYTDLHLLTTPGAAVYQHYQDNGTDYAYENGKYNLYQ
FAKDQAGNVTTAMLHENYPTYLSIYVDPIMSELP

Enzyme Prediction     

EC	3.2.1.84

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	232	671	1.7e-169	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	9	741	18	744	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06604	GH31_glucosidase_II_MalA	0.0	252	585	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
pfam01055	Glyco_hydro_31	0.0	233	671	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	5.74e-174	252	673	1	428	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PLN02763	PLN02763	6.12e-135	148	731	76	658	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08673.1	0.0	4	744	3	744
VCV23578.1	0.0	4	744	3	744
QFJ54579.1	0.0	1	746	1	745
CBK74985.1	0.0	1	749	1	748
CBL13912.1	0.0	98	744	1	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JR6_A	3.27e-125	22	712	50	733	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	4.90e-124	22	712	50	733	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
6C9X_A	7.49e-117	142	712	47	656	ChainA, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6C9X_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]
6CA1_A	2.07e-116	142	712	47	656	ChainA, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6CA1_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]
3M46_A	4.09e-116	142	712	47	656	ChainA, Uncharacterized protein [Blautia obeum ATCC 29174],3M46_B Chain B, Uncharacterized protein [Blautia obeum ATCC 29174]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	5.33e-193	1	741	23	745	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q94502	3.73e-110	165	721	290	864	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
Q9FN05	2.44e-109	165	716	252	828	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
P0CD66	2.68e-108	129	672	45	609	Alpha-glucosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=malA PE=1 SV=1
D0KQM8	3.21e-108	129	672	45	609	Alpha-glucosidase OS=Saccharolobus solfataricus (strain 98/2) OX=555311 GN=malA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000356_02611.