CAZyme Information: MGYG000000357_00349

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000000357_00349
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690		77244.08	4.9388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000357	2815297	MAG	Sweden	Europe

• Gene Location: Start: 47768; End: 49840 Strand: +

Full Sequence      

MLRTIKTKHTSALSFLAALTVTVGMTGSADASVTVVDRPLDGVSNNYTNFRTPLQKAPLL
KLPVGKVQPKGWLRKYLELQRDGLNGHLGEISAWLDKNNNQWLSDSGDHGWEEVPYWLRG
YSSLAYILDDETMKKEAQVWFDAVLRNIKEDGFIGPRNTENGNPELWAQMVMLWALQTYY
EYSGDRAVLDAMTGYFNYELTVPDDKFLKGLWQEKRGGDNLWSVLWLYNRTGDEALLPLA
DKLHRCTSDWTQNGTLPNWHGVNVAQGFREPATYYMYNGDKAMLEASYNNFNIMRELYGQ
MPGGMYAADENARQGYFDPRQGAETCALVEQMASDEILMGITGDPFWADHCENVALNTFT
ASMTPDMKALRYLTAANMAVSDEKLHGPSIDNNLRGMLSMSPFSSRCCQHNHGMGWPYYA
EHLVMATADNGLATMLYAANTTTANVAGNIPVTLTETTNYPFDETVTLTLATGKAVEFPL
YLRIPAWAKDCSVAVNGKPQSVSDAAGRYVRIARKWKNGDVVTLTLPMTVTAQVWQQNQS
SVSVNYGPLTLSLKIDENIEAHDSRDREFVQDDSHWQPGVDASQWPCYVYKPGSDWNYAL
KVDSDNIPVQFKITKRDYPADDMPFTIGNVPFEFSAVGVKIPSWGYDSTGMTDVLPSGDA
SRDREETPLKLIPMGAARLRVSAFPREVVK

Enzyme Prediction     

No EC number prediction in MGYG000000357_00349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	189	551	1.1e-36	0.6958250497017893

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	7.06e-101	99	552	50	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.75e-26	110	553	57	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKW18167.1	6.58e-162	47	685	51	668
QNF41507.1	7.45e-162	14	686	7	654
ADJ45365.1	6.17e-161	47	685	44	660
AFO77076.1	6.17e-161	47	685	44	660
AEK42125.1	6.17e-161	47	685	44	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	8.24e-18	113	592	78	615	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.15e-15	113	592	78	615	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	3.09e-14	321	565	334	577	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	6.40e-13	321	565	334	577	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.36e-07	260	549	247	542	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000347	0.998894	0.000193	0.000205	0.000175	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000357_00349.