CAZyme Information: MGYG000000357_01494

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000000357_01494
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
926		104014.74	5.7228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000357	2815297	MAG	Sweden	Europe

• Gene Location: Start: 9399; End: 12179 Strand: +

Full Sequence      

MIVRKFRCFLLIVLSFTVFAAAARRTIDLAGEWQCSLPSGAPEVVLLPGTMDTNGKGNTN
DNYTETTQLSRKVSYSGPAYYSRDVIIPKNWKDKDIRLTLERTRPSTVWVDGKRIGSQRF
LSTPHVYDLSETLTPGKHTLTVKVDNGDSIPDQIKISSHACVESTQTNWNGIVGKIELTA
APKCFIERMVLEPDVDTRSFRVRAHLSEPFLRKKGKMTIWSGANLIELPVALGQDVVEGV
LALGDTAQLWSEFNPARHRVNAMMQEDDTLSCYGALRKFGIKGHHFTINDTVTFLRGRHD
ACVFPLTGYAPMDVESWRRYFRIIKDYGLNHVRFHSWCPPEACFEAADIEGIYLQPELPV
WGTFNEDEESLMNFLHNDGMAIQRAYGNHPSFAMFGLGNELWGDVKLMQRFTDDFKSVDR
RHLYTYGSNAFLGWQDNLPGQEFWVTCRTGGGDGYSTHVRASFAFCDADEGGYMNNTYPN
TRMNFEDAVQRSPVPVVGHETGQYQIYPDYSEMDKYTGVLEPRNFAEFRRRLDSAGMGSQ
ARDFFNASGKWAVELYKADMEMNLRTPSMGGFQLLDLQDYPGQGTALVGILDAFMDSKGL
VKPEVWRQSCDRVVVMAEFPGYCLKEGDVFNAALSVANYSGKGLAGRKLRWTLTDGDRTV
AAGLCPLDDTVGYSRIGTIEASVPVAGNARKLRLDLEILGTGITNRYPLWAYPAITDDYS
GNVLQTNTLNDSIVAAHLLTGGKVLLTPPYNPADSTTVGPLFQTDYWNYRMFKTICDNAG
KPSSPGTMGILTDQKHPALASFPNDGHTDWQWYDIVKSSYPLILDRFNEENYLPLIQVID
NVDRNHRLGLLMEFAVDGGKVMLLMADPERLTTHVEGRQFMHSILEYMDSDAFMPSRSIT
TEELNQLLTVPTSKSQIQTLRNISYD

Enzyme Prediction     

No EC number prediction in MGYG000000357_01494.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	491	3.4e-58	0.49069148936170215

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.99e-14	27	429	13	434	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	7.56e-11	29	159	4	151	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10150	PRK10150	3.69e-10	22	196	8	194	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	1.88e-04	279	430	1	164	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36762.1	0.0	22	926	27	932
QIU93174.1	0.0	24	926	27	948
QDH53328.1	0.0	24	926	31	952
QUT31373.1	0.0	24	907	27	929
QRM99843.1	0.0	24	907	31	933

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5UJ6_A	2.18e-11	45	401	57	419	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	2.19e-11	45	401	65	427	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	2.88e-11	45	401	65	427	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
5C70_A	9.67e-09	24	400	18	422	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	2.26e-08	24	400	43	447	Thestructure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000468	0.998785	0.000248	0.000158	0.000153	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000357_01494.