CAZyme Information: MGYG000000357_01502

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000000357_01502
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747		82741.65	6.2602

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000357	2815297	MAG	Sweden	Europe

• Gene Location: Start: 24154; End: 26397 Strand: +

Full Sequence      

MNKAFKTAAVAAFVAAASASAGEIVKTSAYSWHGDTITQGPYFATAPNPYEINSTYHAQP
GYRFTINQQWKLKNDISKYPQLRTPNTLHTAIYNMGLDEMVNAVEPDTTLRTGKEWAGVW
TRDVSYSILLSMAYLQPEASMVSLRKKVNANGVIVQDTGSGGAWPVSTDRLIWALAAYEV
YKVTGDRKWLEYIYPVIRKSLDDDAFISETEGGLVKGETSFIDWRTQSYPRWMQMTDIYN
SEALNTSVVHAQALRVLADIARESGDRKVAADSDARADKIEKAINDKLWMPDKGYYAMYT
YGRNFNILNPRAETLGESLAILYGVASPERAASITENNPTTPFGTAIFFPQIVDEPPYHN
NALWPWVGSYWAMANAKVGNEQGTLEAIGAVFRPAALFATNKENFVLDNGDIATQLNSSN
MLWCLAGNIAITHKILFGIEFEKNGLAFHPFVPKTLGAERTLEGFPYRKATLDITVRGYG
DKIKSFTLNGKEHKPFIPADIKGKNTIVITMADNDIAPMKVNHSNNDKAPVTPSVWIRDG
KLQWDPVSYASAYIVLRNGERIASTRQLSYPLTESGEYQLIAVVGGIESFATEPLSNREE
LIFQFPGETTVMTSPEVSYKPAGQIEGYTGTGFVELDHKSAPVTLTVDVPTDGTYSVAAR
YTNGNGPVATENKCALRTLSVDGKRAGVLIMPQREKANWNDWGLTNMLTVPLKAGRHTFT
IDFRPENENMNLRTNHALVDCLVLEKL

Enzyme Prediction     

No EC number prediction in MGYG000000357_01502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM35	624	726	8.3e-18	0.773109243697479

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	1.93e-20	627	727	22	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04086	CBM35_mannanase-like	2.87e-10	624	722	18	105	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
COG3408	GDB1	1.16e-09	171	382	342	555	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04082	CBM35_pectate_lyase-like	1.44e-09	627	718	21	105	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
pfam17389	Bac_rhamnosid6H	4.15e-09	160	297	78	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK61875.1	3.94e-231	65	742	211	886
QTE38578.1	2.03e-228	49	740	204	882
AWG27199.1	2.36e-225	50	747	196	893
QDA62675.1	4.86e-224	50	747	182	881
AKQ46615.1	2.07e-223	70	747	228	905

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X7G_A	5.66e-06	595	727	395	516	CrystalStructure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase [Paenibacillus sp. 598K],5X7H_A Crystal Structure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase complexed with cycloisomaltoheptaose [Paenibacillus sp. 598K]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000372	0.998819	0.000216	0.000208	0.000193	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000357_01502.