CAZyme Information: MGYG000000358_00735

Basic Information

• Species: UBA1436 sp002329395
• Lineage: Bacteria; Elusimicrobiota; Elusimicrobia; Elusimicrobiales; Elusimicrobiaceae; UBA1436; UBA1436 sp002329395
• CAZyme ID: MGYG000000358_00735
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000000358_28|CGC1	43338.78	9.9804

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000358	1561461	MAG	Sweden	Europe

• Gene Location: Start: 8055; End: 9209 Strand: +

Full Sequence      

MSSFTPITKNILVIAGDVSGDIHAAGLIRALKEADPDVRVTSVGGKQMQAASDVFLYDLA
SKGASGFVEPLKKMPLWIKLMNQIREYMETQNPVALIVVDFYGFNHQILGMAKHRRIPAY
YYVTPQVWASRQYRAKRLATLTKKMFTIYPFEPEFHQKFGGNAVFLGNPLLDQLPAPKDK
NFNVPNNKEYAWKLGMLPGSRIGEIKRLTPVFYQAFKQVLKEFPNTQAYMFLLPDADEQT
FLNLIGEKPHANFRLVKDKNYELRSQMDFLLACSGTATLENALLGVPMVVAYKLFWPTYQ
IAKMVIKVPYISLVNLLSKKPLVKELIQYDATPRSLAAETMAMFQNPAKLEAMRGELLKL
RASLGEPGVAKRAAAEILRDLTHE

Enzyme Prediction     

No EC number prediction in MGYG000000358_00735.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	11	364	7.3e-103	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.61e-114	11	379	4	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.50e-102	11	378	4	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.02e-78	11	339	1	334	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.93e-75	1	378	1	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.00e-47	9	377	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACC99056.1	4.89e-156	1	381	1	374
AIF53764.1	5.86e-75	11	378	4	372
QJB55139.1	5.82e-74	16	381	15	374
AKL97836.1	2.35e-72	9	380	4	361
AJQ25963.1	3.21e-72	11	378	4	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.12e-47	1	364	1	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.12e-47	1	364	1	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	5.84e-70	8	378	3	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B8JE78	8.59e-66	7	378	7	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	1.21e-65	7	378	7	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	2.40e-65	7	378	7	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q3JAC1	2.93e-64	11	377	8	373	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000358_00735.