CAZyme Information: MGYG000000360_00097

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_00097
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1009		113628.65	9.7821

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 126474; End: 129503 Strand: +

Full Sequence      

MKKNNWSICRSAAAAAVLILPVAAQAAMLLDCGKMKPETVLLHTPEKRGQSVRGESLEQL
GALRIDWDCARSGHFEFQLKPGVKLPEFRTAQIRVRAFIPEDGKSRNLNLRITDRDGETF
QFSRPLAAADRGWREFVYEINAEKPKAGSWGKKANRRIDFPAKFTGFASDFNSRKGKGYL
GIGTVEIEVLHSGQPLQPQLDTGSPLRILTPEQKEVPGISLVNTRREKAEGELFYRVTDA
FGTEQENATRRITLAPGGKLLFPLMKPAKFGVYYVDVRFRENDPRLKTFEKQFRYCYMQP
AGPTPGMAKGFLFGVCSHPQGLSDRDLELEAQAAALCGIKIMRTDIYWERIQPTPDRWLF
GSFDRVMKSFGAQGIEVQAIYCYLPKWAIAKEWKPLAANYKGRQRPDYEHWRKFIRTFAE
RYRGKLRYVEVWNEPDHIGFANFPVSEYIEMMKIAYAETKKAAPEMSVLTGGYTGMPGSS
PKMKEKDHMTRTLTEGKGAYDVFAFHGHGSMSSYRHQINRLVKMRRELGIEAPWYANETA
ISAILIGEMKQAEILFQKFLYSWANGAIGYNWYDLRNDGFDPNANEHNFGLITRDFQPKA
AYAVYNALAGAYREAKFLRVMRFGGSVEAFLFKAKDGRLLLAVWNNDPGCDGIPLCLSGV
SGQAEVIDLFGNVTSLPVRSRNLIFKAGRSPVTIRLEANAAELKEAGEFLKSGLVFSVTP
GRESEVVPEFCNPTSRPLTLELNWTPPKGVTTAVKQKFRLKPGERRKLPLKIAAAPEFRS
PDSRPAEMKLELALGGLWRGELRYPVRSVIWLETKMPQAPVFVLRDAAQVIPFVPNVPEK
EHLFWKGPADLSSEIRLAHDRKALLFEAVVTDDVHHQPCSGAEVWRGDNIQMALQLPGQK
GIWELGFTRLGDGKSEAFVWLTPSGFSAEKAAGAIRVETARDEKKKQTVYRAAVPFEAIG
LNETVKKRGFRLNLIVNDNDGEMRESCIGIAPGIAENKDPERYPIIKFR

Enzyme Prediction     

No EC number prediction in MGYG000000360_00097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	360	646	2e-26	0.7146171693735499

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.30e-79	820	1008	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	1.20e-10	843	985	10	153	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	1.35e-10	845	993	30	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam06452	CBM9_1	1.44e-04	849	989	29	161	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
pfam02449	Glyco_hydro_42	2.50e-04	324	437	13	140	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	7.97e-270	39	1008	59	1032
AHF90198.1	5.25e-266	38	1008	32	1005
AVM46276.1	2.60e-163	47	1008	29	1136
AVM47149.1	3.96e-157	63	1008	214	1306
AVM44759.1	5.55e-157	230	1008	196	964

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	2.23e-16	314	637	107	438	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000781	0.998259	0.000217	0.000277	0.000221	0.000208

TMHMM  Annotations     

start	end
7	29