CAZyme Information: MGYG000000360_00712

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_00712
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678		77757.3	9.7124

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 924319; End: 926355 Strand: +

Full Sequence      

MRRLITLLSLCFGILSAQNPLPPQELRVEETARSTGVSARISDGRDIEITAAGNLPWIGL
HLKPLDKTGWDLSAFRYLECEAVNHRKNGFCGVAFYMNDQFLGRTAIRPGETRKLRFKLN
HQAPGRFDPGFPARLTGVPDGFRGGRNIDTANVTRFRIETFAPGKAHFSIRKLRASGHYA
PPGEVLTPNDFFPCIDRYGQYIHQEWKEKIHTDSDFRKNLQMEEHALRSPVPAWNQFGGW
EAGPQLKATGFFRTEKYRGKWYLVDPSGRLFFSRGINSIRYSDVLTGGTGAEKFFEGKST
RKNGKFGFTSENLKKKYGENYRERFGRFMMRRMADWGFNTLGNWSAHDICRMRQHPYVVN
LPLPSGLPRLAKGGFYDVFDPAFEPGMQKIFSKEFDWCKNDPWCIGIFIGNELRFSNRKR
SLGTDALTAAPQTAAKKELLRDLQKKYSSIASLNRVWKTRFTDWEELMQLRELPAGNAWK
KDIDDFFEKSVRRFFAVSKAVIKSNSPNTLYLGSRLFVGYDYRNERLNRAAGEYWDVVSY
NLYQPHYDHFAPHGLPDVPVIITESSIGGCRARGGWGIHSDPGLMPDARKEAFLCQYESA
ARHPNIVGIHFFCLFDQPVLGRWDGENCDFGLLDITDSPYTDVVKANREFSERLYEFRQN
TEPVFTFQQMNPRQPAGK

Enzyme Prediction     

No EC number prediction in MGYG000000360_00712.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	148	655	6.3e-100	0.8376722817764165

CDD Domains     

MGYG000000360_00712 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP07841.1	1.07e-125	39	658	58	691
AHF89585.1	4.37e-125	25	659	26	681
AVM45357.1	1.11e-119	6	660	10	675
AHF89577.1	9.81e-114	62	658	70	688
AXP07838.1	4.45e-102	47	659	74	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	5.73e-61	182	658	191	746	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.49e-60	182	658	191	746	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	2.29e-59	195	658	223	762	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	1.24e-56	144	658	176	762	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
5T3B_A	1.64e-13	182	655	27	473	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	4.04e-68	144	658	385	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	4.45e-38	196	655	400	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000419	0.998777	0.000287	0.000185	0.000160	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_00712.