CAZyme Information: MGYG000000360_00812

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_00812
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000000360_2|CGC1	38873.93	6.3822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 58833; End: 59885 Strand: -

Full Sequence      

MAIQKYTVSNDPAIYEAWPDVVLTGSGTMLCVFSECTHHGNRSYTRIMLTESGDRGRTWS
PKRPLTEGTAGRNYYYNCARIAKLSDGRIVISLDRVPLDCKEDTGRSEILLFFSDDNGKT
WSAPLTTPVKGIVPDKLTELDNGRWLLSAHYRHNGRLTQFLHYSDDKGASWSPRITVAES
PALNLCEVSMLPLGGGTVVGFLRENSAQGWDCKKVISHDSGETWGPIVDFPIPACHRPTA
GLLQDGRILITCRLMQGGKGWLGAWTQNLLAVLTDRESVLADSRSGSRVRILPVDYDRSP
FADTGYSGWVQFPDGGIYIVNYIVDDAYDKAQIRGYSLSLNDFILPEKEN

Enzyme Prediction     

No EC number prediction in MGYG000000360_00812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	19	239	5.3e-26	0.6900584795321637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.73e-27	19	320	17	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	9.47e-22	5	251	72	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	7.10e-13	27	250	1	225	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	9.70e-09	8	250	42	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	4.68e-04	111	230	3	115	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44758.1	1.32e-178	3	345	2	345
AYB46154.1	9.05e-134	1	345	1	342
ANY72719.1	5.37e-133	1	345	1	342
AHF91127.1	7.54e-112	3	346	2	358
AHF89372.1	4.90e-82	3	349	2	357

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_00812.