CAZyme Information: MGYG000000360_00996

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_00996
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
986		111660.91	9.5247

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 283245; End: 286205 Strand: +

Full Sequence      

MLKPLIVCCCAVAYSLSAAVIQDFSVDRPPVPVWKGKALRQSAEYVGDGLLVRWDTALNG
ACIFGEPWKKTFTVPEFEQANCRVDVEITEPSPMREFCVRFTDSRKEVFQWRASVDFRKP
GTYRVVIPMTRKNFRHAFGGNKDRNIDFPMRFYSCVVSAPKNSGTASVLVKKISFEFSPV
KSEWNAVKFDIETGNAARVLKKGEEEKLRFLLRNPGSTPLSCRARMEFRDFSGSTIAESA
ELTLPAGGTLEYQPKTRLPHFGHWNVLMRLEAVDGSGFAERKRSLAYMVPAGPGKIGKQG
FVFGICIPGWYDTKIFPLEAETASLCGASALRLNFRWRELERKPDEWHLAMLNRIMKEYE
TRGMEVMPILSNPPVWARSDKNKPNSLPDFREWRKYAGFFFRNYGDRIRFWEIWNEPDLF
SFCDFSAPDYVQLQKIVREEQKKFAPHVKILTGGFAHAYPENNKNGFQEYVLANGKEYFD
IHAFHGHGGFKAFRRQVEEFLLPMRKRAGVTVPWYANETAVSAYGFGERRQAETLFKKFL
YSWSAGAIGYNWYNLRNNGFAANDPEHHYGLVTFDFYPKPVYVVYNTLATVFRPMEFVRR
VNPGTDIWVLEFAGGGDRAVAVWNDTPEKVADEPAVFRTDAESVEAVDLMGNRRKLAVTD
GIVIHRISGTPETLLFHKAAYARYAGALVKGWVNGGAVPGLVPAELHVALFNPFDGARTY
DLSVNGGKEMQITALPPEIRLQPGERRTLSAKILLKPGARGAQNPELSVAFPGFHTVLRV
PMEHAILIPRNRKPDEWDFILRNRDQVHALFDADPGNAHKLWKGPGDLSAKIRMELKGDA
WILKFAVTDDKHVQPHRGFHVWQGDGVQIAFSLPGQKGLWIAGLTLLVDGKPELFLWESP
ASFAGKHPVKQWNLNARRSGTLTEYEVRIPLASIGMTPESWKKGIRFSALINDNDGFGRE
GWIQISEGIASNRSAEKYPLILFEQK

Enzyme Prediction     

No EC number prediction in MGYG000000360_00996.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	352	629	3.2e-19	0.7169373549883991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	9.21e-55	797	983	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.06e-10	820	961	28	167	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	1.63e-08	822	963	12	156	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd21510	agarase_cat	5.92e-06	395	469	81	163	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46276.1	1.86e-183	163	984	306	1137
AVM47149.1	5.17e-174	36	984	200	1307
AHF94342.1	2.52e-161	50	985	83	1034
AVM44759.1	1.08e-152	189	984	160	965
AHF90198.1	4.80e-137	7	983	11	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	8.74e-13	304	733	107	581	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.999039	0.000176	0.000150	0.000142	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_00996.