CAZyme Information: MGYG000000360_01029

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_01029
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	MGYG000000360_2|CGC3	67422.19	6.0448

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 322635; End: 324410 Strand: +

Full Sequence      

MMIQSTVGEICVKGDFGTAWTLSHTQTVLEPGLEVIRLHLETPDELPPPGFTLSWSVPQL
DMQTRWHPKSIFNRYIPADWGGSTESDLATSAPLMAFLNLKGQNRLTFAVSEAKRFVKFS
GGVCEESNRIGCKIELFTVPEAPLHSYDVELRLDTRSIFYADAIRSVAEWFASFPEYKPA
VAPEAAFEPIYSSWYSYHQQLFDHELEAECARAGEYGMKGIIVDDGWQTDDSNRGYAFCG
DWEISKKRFPDMRAHVAKIHALGMKYVVWYSVPFVGFKSRAYDRFKGKFLYENQRLNTAV
VDPRFPEIREYLINIYETAIREWDLDGFKLDFIDSFCYYVYGFKDPAVAENYAGRDIKSL
PEACDVLLSEIMRRLRALKPDILIEFRQSYIGPAIRKYGNMLRAADCPADILSNRLRTLD
LRLTSGNTAVHSDMLEWNENETAELAALQLLNVLFSVPQISVRLDRIPESHRRMLHFWLD
FCIRHREVLLHGYLKPYHPEMNYPIVSSETAREKVIAVYNYGQVVKVACDPGKPCYVINA
TGRSELVLELQNVPVSAELFDTFGRPVSVPVLKAGPARVSIPYSGLLVLNF

Enzyme Prediction     

No EC number prediction in MGYG000000360_01029.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.12e-62	186	481	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	2.93e-10	188	343	2	161	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	3.10e-08	202	331	53	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	1.57e-06	191	357	5	152	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG1501	YicI	2.97e-06	178	342	257	425	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	2.00e-254	1	591	1	587
CQR55726.1	2.24e-186	9	554	10	550
QGQ97599.1	1.01e-185	30	590	30	588
AIQ68815.1	3.62e-185	13	590	17	590
QQZ59668.1	2.06e-184	9	590	10	590

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_01029.