CAZyme Information: MGYG000000360_01425

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_01425
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1141	MGYG000000360_3|CGC2	128488.11	9.7623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 142047; End: 145472 Strand: +

Full Sequence      

MKSILTLFLAGVLVLPAFSDSREFSADLNAGGQVDWVGVSQKQQVPYSKEHQGLFFRTDT
GKAHHLQLSLKHPFVVREYETLYASAVFSTDQDSPVSGLDLRLRDKDNEIGAIRPIRFEN
KNGTITAEWKITPERLKTTWGTSKEKQNHFMDPPVRVFALGISYNRKTDREFFLTLRSLR
FRLTTGNTVSATRPLWSFGRDFLPQQSGGYQLYRAGDALIVNNIRTGKGWLRELKKAGLV
HFQEKPRAIELDAEAITGKVQASWTLKDAANRTFTTPPQTVQGKRKTYRFDLAAVPLQPP
YRVDRLTLQGTPEQQSSLILHGSRLAVQSSAAEALRFDVMTGTPVHVLKHDRANAFHYLF
TNTSQKSGKFKIKVSLIPYNGKTLSETFELDVKPGERIVRVPAIRPDRNGHWTAVAEISH
PATNGLSIQQTPFAKLIPAGPTPDGNPEFLFGVCSHPERWSDRDRELEYQAAALCGIKYL
RATPGWGYVQPTPGEWKTDYLNGQLETCGAYGIELQGFLGFNPKWAVPPELQKKHWLVWS
RSYPDETAFAAYAQRMAKEFRGRIRNWELWNEPELQRGAISAEEFTKLQKLAYKSVKKGN
PDAVMMSGGFAGGNTHQAMKDKQFMEKVLKNAAGSYEIHLTHNHGNFGAYVAVVEQHLLP
LRKRAGADRIPWFPNETAISSLFGTERNQAQTLYKKLIYSWARGAIGYAWYDLRNDGYDA
SNGEHNYGMITTDFRPKPVYSVYNHLARTFRKAHFAEQFAAPEGVWAFRFETPEGQLVPL
WNESDLPVLLALKSDAKQARLSDFMDNESPLPAQDGVVLVQAENEPKTLRLAGASSARLI
GPLLRLKSLDVAVPERTMTLKVNVRNPFPKPREFRLSLSALPDGFRAEQPSVSVTVSPDK
TVTPEFRIAVPGKERFPNHAVSFLLQCQTGSVKTALRIPVNPAHLVEGVKTGKPDFVLDK
KAQVVSQTEADPQLAHRIWKGPADHSARIRLGETDGVLELLVDVTDDVHSQPYSGFNVWK
GDNLQICFKFPSQDDYWELGASLLDSGKPEMYVFHAPRRFRKEEVRKQLRLTAERKGTTT
SYRIRIPLDACGWTPAMLRGGFRFNLLVNENDGEGRDGWLQIAPGIGENKDPERYPFILF
D

Enzyme Prediction     

No EC number prediction in MGYG000000360_01425.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	7.79e-62	954	1140	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	1.20e-08	978	1116	11	152	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	1.32e-07	979	1125	30	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam06452	CBM9_1	0.001	983	1120	29	160	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	2.10e-245	28	1141	189	1307
AVM46276.1	8.82e-222	43	1141	34	1137
AVM44759.1	3.49e-159	318	1141	143	965
AVM45104.1	1.41e-119	99	1139	86	1133
AHF94342.1	2.34e-113	283	1141	172	1033

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	6.28e-20	452	829	107	496	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000415	0.998550	0.000296	0.000253	0.000238	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_01425.