CAZyme Information: MGYG000000360_01525

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_01525
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		51888.57	5.4249

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 270214; End: 271578 Strand: -

Full Sequence      

MFVKQCGPMKADFGTRNGMIRKRLHGSNYMPNISSQNVVDFNREFAELHLTESRTHDQAL
NNPGQRVVDTVFVFPREEADPADPANYYFKATDWLLRNLLSCGTQVYYRLGVSIEHTLPG
HHFNTEIPKDNLHYARILAGIIRHYNYGWADGFRMNIPCWEIWNEPDLDARMWNGSREQF
IRFFCDVLKYLKQEFPDEKIGGPAMCWLHREWLEPLLAACRDEGIAPDFISWHSYWSDPV
GLIRQTEEMRELVDSFGFTETELHLNEWHYLLTWDGLHQNVTEEKFLKAMNGPAGMLGID
SAAYNTALFTGWHDSPLDAACYYGAGRPAAGSPFGFHTLTRRLNKNYYSLKMFGAVVHGY
PVRIAAEGGTETQWILAASDEAGKRGALLVTDYRGEETEIEVEIANIDGASGWNVVLLDQ
NHDELEIPARFRDGKLLLKKLSPGSAVFLVTFEY

Enzyme Prediction     

No EC number prediction in MGYG000000360_01525.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	80	280	1.1e-31	0.5150812064965197

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.74e-10	87	268	74	271	Glycosyl hydrolases family 39.
cd21510	agarase_cat	0.007	160	207	102	153	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46100.1	2.05e-92	11	449	6	432
QGA22857.1	2.11e-72	22	423	128	520
AVM46102.1	1.72e-62	12	450	10	430
QEL16017.1	3.13e-61	24	450	41	463
QEH37425.1	1.53e-59	22	451	41	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z3K_A	2.05e-29	22	325	21	304	Crystalstructure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus],5Z3K_B Crystal structure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus]
6YYH_A	7.74e-13	69	269	82	302	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]
1PX8_A	2.29e-12	87	269	77	279	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
5U22_A	1.72e-09	161	268	143	247	Structureof N2152 from Neocallimastix frontalis [Neocallimastix frontalis]
4EKJ_A	4.46e-08	161	287	159	301	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30360	2.21e-11	87	269	77	279	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	1.61e-10	87	269	77	279	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
P23552	1.03e-07	86	238	79	234	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_01525.