CAZyme Information: MGYG000000360_01629

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_01629
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		54929.56	6.5792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 407582; End: 409024 Strand: -

Full Sequence      

MIFNTERGPFPPAFKLVEMGRLASVDSEKSTATRLSVGFETLDRELFDPEPCYELLAATG
VKWARCQSGWFRCEKEPGKYDFAWLDRVIDRFCEVGIRPWLGLTFGNRLYSPDAKHPSAV
GCPPVCYGETAVKAWQKFVRAVVDRYRGRVTHFEIWNEPDNWQFWGPGKPSAGQYLELVR
CTSSVIRETYPEAKIIGGAFSNPLTAVKCLRLGLGRFCDILSYHSYSMYPEFDSRNPVDL
LREAIREHAPHLELWHGESGCPSESKDHYDEWIGLFRSSQEIQAKWLSRRIATDFRNGLK
LFSYYHASDLTLRPYVNGEGVPTKVGRMGLIHAPDAVPKLSWSVLRNFCSVFDSSLKPKA
LRVRLGYDDIYDPCRMPEQPRDLFTNVIADTWSRNGYPLYLYYYPGDLQRSETLSALSGS
VFQAEAEEKITDPVLLDMLTGTVYGFRQFELDNGILYLKTIPLTDYPLVITDRRALSMQE

Enzyme Prediction     

No EC number prediction in MGYG000000360_01629.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	78	233	3.4e-34	0.3805104408352668

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	5.63e-14	60	250	47	263	Glycosyl hydrolases family 39.
pfam02449	Glyco_hydro_42	1.15e-05	60	147	23	163	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF92635.1	5.68e-126	16	478	35	501
QNN22730.1	1.58e-95	11	476	42	484
ASV73290.1	3.63e-84	19	476	70	527
BCB83269.1	7.62e-75	7	262	23	282
AWI10371.1	1.03e-67	15	471	60	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YYH_A	5.76e-10	80	199	100	222	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]
1PX8_A	3.96e-09	80	199	77	199	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
1W91_A	1.42e-06	80	279	77	267	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	1.42e-06	80	279	77	267	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30360	1.30e-09	80	199	77	199	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	2.17e-08	80	199	77	199	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
P23552	2.49e-06	71	246	71	252	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_01629.