CAZyme Information: MGYG000000360_01633

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_01633
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		50151.23	6.5992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 412753; End: 414036 Strand: +

Full Sequence      

MLNLHNYPAITFPETFLWGSATAAHQIEGDDIHSINWRDQTMYPERFIHHSGKACNSYQL
YKEDVELLKTLGHQAYRFSIPWSRIEPEEGKFCREAVDHYIDLLRLLKEAGIRTFVTLSH
GSDPAWFWDKGGFANRNAFPYFERYVNFIVPQLEENVDFWMTINEINIMERPGYDKFELR
KNYMICHAKAFRIIRRYSGKPVGAPHAMAAVVPKDPHFEGDKAFAAMEDWLFNGFFYHAL
RTGELVFPHYPAETFPEMKDSFDFWAINYYTRKEVSSRTKNGGAVLPTCEQLKLIDKEFY
MSSFYPEGLCNELQRLKDKPVCITENGCCCADDRWRIVKLCQDLSAIRDAMDSGVDVRGY
LHWSLLDNYEWVSFIPRFGMVHVDFKTFERTPKPSAWMFREIIANHGFTPDTVRKYLPEL
PEFKLFR

Enzyme Prediction     

No EC number prediction in MGYG000000360_01633.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	11	407	6.4e-102	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00232	Glyco_hydro_1	1.50e-90	10	408	3	453	Glycosyl hydrolase family 1.
COG2723	BglB	3.75e-89	11	411	3	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PLN02814	PLN02814	1.13e-37	12	396	28	473	beta-glucosidase
PLN02998	PLN02998	5.92e-34	7	396	26	478	beta-glucosidase
PRK09852	PRK09852	1.11e-33	11	407	3	470	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43515.1	4.62e-145	1	427	1	421
ADW18818.1	2.06e-137	1	421	1	430
ADQ08048.1	2.79e-115	1	421	1	424
QCX34294.1	9.53e-115	1	421	1	422
QNM13665.1	7.96e-103	1	424	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	4.24e-77	10	420	3	421	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6Z1H_A	2.43e-71	9	407	8	449	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6IER_A	7.36e-54	10	396	30	421	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
5OGZ_A	1.79e-53	10	408	4	448	ChainA, Beta-glucosidase A [Acetivibrio thermocellus ATCC 27405],5OGZ_B Chain B, Beta-glucosidase A [Acetivibrio thermocellus ATCC 27405]
6JFP_A	5.57e-52	10	407	2	442	Crystalstructure of the beta-glucosidase Bgl15 [uncultured bacterium],6JFP_B Crystal structure of the beta-glucosidase Bgl15 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26208	8.22e-53	10	408	4	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P22505	3.54e-48	12	408	8	448	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
P22073	6.88e-48	12	406	6	442	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
P10482	8.17e-46	10	407	3	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
Q03506	2.00e-45	12	404	6	444	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_01633.