CAZyme Information: MGYG000000360_01811

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_01811
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		65114.43	5.4229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 46898; End: 48643 Strand: -

Full Sequence      

MIYRLSDQLPLEFHDLPASARITAENTDGVSIVTVEPGPGCSRFSVEWQLPQDDIQFRWV
SAAGKIGEGYPQFLPPDWFSAMTTELCRHAPVFSLVGADSGNRLTAAVSESVEPVLFRCG
VSEETFMMQCRIECTAVTPESRIVFRFDQRRVPFSESLREVAVWWENLPGLRPMPVPASA
FDPVYSTWYSYHHGISADAVGQEVKSGLEYGMKTVIVDDGWQKIGRTGSYPSTGDWLEAD
RFPDMKQHVRRIRETGVRYLLWVALPFIGEESRVFPGLKEKLLYFSGALRTWILDPRFPE
VRNHLVSTCVRLVKEWELDGLKLDFLDRFPLPAGIPDPADCAPDAGRDCPGVDEGVNLLL
DELTARLRAVNPDVLIEFRQDYIAPAMRKYANIFRASDCPGDRIANRRRIINLRQLSGGT
AVHSDMLGWSPEEAVESAARQLWNIVFSVPQLSVRLADLPEKHRRMLAFFLNFWTENRTL
FLHSGLTPLHPELNYPLVMAENGNTVAAVLYSEQALRITGLSGRRLIVINATASPELLLQ
FQGKETRAEIRDCCGNPAGGVTLRDGIRSIAIPPSGVLVTE

Enzyme Prediction     

No EC number prediction in MGYG000000360_01811.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	100	401	4.2e-29	0.42877906976744184

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.40e-54	183	474	4	297	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	3.09e-14	183	334	3	160	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	2.94e-09	137	398	254	505	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06597	GH31_transferase_CtsY	3.47e-04	171	268	1	89	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd14792	GH27	0.001	185	245	5	67	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41069.1	1.61e-147	44	579	52	587
AVM46708.1	2.50e-147	17	578	21	583
QJD86820.1	3.74e-142	46	581	51	601
QQZ59668.1	1.81e-141	30	581	38	590
QSF42796.1	2.46e-140	29	581	33	589

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43469	7.97e-10	83	324	237	472	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
Q6NSJ0	5.46e-06	174	324	307	463	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	7.19e-06	172	324	302	462	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_01811.