CAZyme Information: MGYG000000360_02229

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_02229
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000000360_5|CGC1	82060.97	5.7525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 22796; End: 24991 Strand: -

Full Sequence      

MSFSDTRIWNGFWISFGETLTDWSHRIFPAPYFRREFEIQRGKTYKLYLCGLGYHEVRLN
GNKVGNCELAPAPTNYDVHAAYLVYDLTNLLADGRNTLGVILGNGLYNCHTEEVWHFDKA
VWRDYPKLLLELTCEEQTILTSDDTWKVSLDGPITFDGFRNGEYYDARLEQPGWDRNGFD
DSAWRSAVIVPGPGGELFEQTAPPCRVKALFPMRRLESGTWDAGQNIAGRAELAVRGTRG
SSVRIQYGDVLNADGSLHLNDIARFVRSGEFQTERYTLKGDGTETWHSRFTYHGFRYATV
EISGDAEILSLTAQAIHSDLTETGGFTCSNPDMNALESCTRWSFLNNFVGIPTDCPHREK
NGWTNDTQLASDTGLFHFDLTEAYREWLGTLRDCQRPNGQLPGIAPSSGWGYNWGSGTLF
DAALFGIPRSIYIYRGDSSVMRENYNAFKRSVEFAGSLAKDNILRFGLGDWQHYDRSRAV
APELPMTGWLFHNLKILAEAAALFGFPDDAKRYAEKSVRVAEAFRRAFSNGNGSYANDEK
TALAVAAGFGLCTGTEAELTAALLNRKVCEDRYIADFGIVGAKFVPRVLAEHGYAESAFR
IFTQEHFPGWCNWVRSGETTLLEDFAGKCSHDHIMFGDLSAWMMQYAAGLEPDFRRPGFC
EVVLKPRAIASLNSMSAWYDSIYGRISIDWKREADNILFSARIPAGIPGKLIRPDGTESA
FRGTITTNWKG

Enzyme Prediction     

No EC number prediction in MGYG000000360_02229.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	221	711	6.3e-125	0.9742063492063492
CBM67	29	194	7.3e-30	0.8920454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.93e-79	322	646	2	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.03e-52	47	208	8	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.72e-24	214	317	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.36e-11	649	719	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44981.1	4.70e-252	7	718	27	746
AVM44977.1	2.29e-216	30	707	17	697
QGQ94103.1	3.08e-180	1	730	115	853
QNN24933.1	1.27e-171	29	714	351	1055
AHF16194.1	7.43e-170	30	721	172	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.51e-113	24	714	170	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.28e-84	30	704	302	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.83e-78	19	690	123	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.04e-86	28	712	182	905	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.99e-83	30	704	302	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.23e-83	27	719	171	885	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.81e-75	9	731	146	900	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_02229.