CAZyme Information: MGYG000000360_03074

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_03074
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		66591.75	9.8109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 205122; End: 206888 Strand: +

Full Sequence      

MKTTLITCAAVLAALSLNGGSLMPVKGRISIAGADGTSFRAKDGTLTLKREKPSFQQFMR
GIIRFKPHLDGNFAQDDALVIELKTAKDFDLRLRWRKSDRMMCHLDNVPVKAGKGFQEIV
VPMPVTGGKALESLDIQLSPDPGMVEIRKIAIEKPKKVTLAITSPITKAQDELVFKGTTA
APETDVKICIRNSRGEVKSKTVKSKQGKFELRWKRPPVNIGLWNTAYAEIGDGKASANVS
IPLRVFGYRANDNYAWLKVKGRDIVTSKESKGGEQAFIPVGIGYCRDVIIPAQDEEVMKY
CKERGLNTVRLPFYTRFFNNKESEPLDIDEHIRDFVLPVVLAAKRHNLYVILDDHGYFTA
KIDEAKARQKQSAPRWNEAGFNEWIRRWVKVAEFFKNEPTVLGYELLNEPHDIPHETTRK
WYTNCLKAIRKVDQRHIVLLGNADWSHSRTIEKTWGPVASTVDAPYNNVVFSFHDYPEDN
HPWIVADHITKFQKKHNVPVMCTEFGATHWNKSETVCRTFISGVITLFARENTGWMIWAL
KYLKDNPRAPYNPVDKVGINPPSYDSCSYSDIWIPAAKIMASPFPKAK

Enzyme Prediction     

No EC number prediction in MGYG000000360_03074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	291	546	1.3e-44	0.7381818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.17e-28	294	542	26	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.53e-11	295	508	76	324	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT89144.1	2.42e-159	252	585	29	363
QEC61327.1	1.77e-23	300	545	102	336
AIA99611.1	3.49e-23	295	546	103	346
AIA99600.1	4.99e-22	295	546	102	345
QIK53840.1	8.93e-22	295	541	101	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NCO_A	1.53e-13	294	531	43	285	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
3RJX_A	1.53e-13	294	531	43	285	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]
3RJY_A	1.53e-13	294	531	43	285	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]
3AMC_A	1.99e-13	295	538	36	286	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	1.15e-12	295	538	36	286	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	8.66e-12	300	478	78	258	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
P22541	1.59e-09	305	506	161	336	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P23548	3.31e-09	295	506	80	319	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
Q6L6S1	4.73e-06	382	445	203	280	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.056950	0.794593	0.147470	0.000339	0.000302	0.000310

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_03074.