CAZyme Information: MGYG000000360_03172

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_03172
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000000360_8|CGC2	43705.63	10.005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 78152; End: 79321 Strand: +

Full Sequence      

MNPGRKEIWIIAGEASGDLYGARIAAELKRRRPDVVVCGMGGVEMRKAGVELLVDSSELG
VIGLVEVLENIFKFIRIMLYLIREAGKRRPLEVILIDYPGFNIRFAKAMWKAGIPVVWYI
SPQVWVWRRGNIRKLAKYCRKLMVIFPFEPEVYEGSGLDVEFVGHPLVDIVQGRADATIE
RDPNTILLLPGSRKKEIEFLLEPFLKTAAILKSRHPNLQFVVASPRERILQMVRQGLEAF
IRKHPDYPLPKIELTRGKTAFWMQRCTAGLAASGTVTVECAIAGLPLVVAYKLNKLTFLL
ARLIIGKLFRGFFTMPNIILNRCVFEEYLQHQVIPEDLADAVDRILPGGERRGQVERDMR
EMVDQLSGGANGAIAKTAVSALKAIQNGM

Enzyme Prediction     

No EC number prediction in MGYG000000360_03172.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	366	1.5e-107	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.84e-124	8	383	4	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.24e-111	6	379	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.80e-85	8	366	1	358	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.59e-78	1	382	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.67e-47	53	341	42	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	2.45e-147	1	378	1	379
AVM45461.1	1.73e-129	5	373	11	380
QQG66459.1	3.15e-75	6	382	14	391
CBE68704.1	4.46e-75	1	388	1	380
ADW17729.1	5.92e-75	6	382	9	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.71e-48	8	366	9	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.23e-48	8	366	9	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.10e-71	6	386	4	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.35e-69	1	369	1	366	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
B8JE78	1.06e-68	7	346	10	345	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	5.86e-68	7	346	10	345	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	1.64e-67	7	346	10	345	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_03172.