CAZyme Information: MGYG000000360_03384

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_03384
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000000360_10|CGC1	38141.51	9.8858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 20709; End: 21740 Strand: +

Full Sequence      

MKKRFLIVKPSSLGDVIHAFPAVSLLARHEPEAEIDWMVVPAFASVVRYHPAVNGIVLFR
RKELGQLPKFPKAFSELLSGIRKARYDGVIDLQGLLRSAVISRLAKTRVVAGPAVSREWG
TGIFYQRRLDPGDRFRHAVRKNLSMMAEFLGVPEPDKAEFEFKANPVAAQRVVTLLRGSA
KEKLIAVAPGARWHSKQWPPEFFAETLNLFYRDHHDDYSFVILGSPDEKPLGEQLQKHLK
APAVNLIGLTGIPELVEAIRRSRLLFCNDSGPMHIAAALGTPLVCMFGPTDPVLTGPFSD
RAEILVPPLECIKCFRRECERGECHRAISAGDAKKSAEKLLGI

Enzyme Prediction     

No EC number prediction in MGYG000000360_03384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	77	323	8.6e-59	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	5.97e-66	4	330	1	265	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	7.85e-64	3	341	2	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	3.05e-50	81	319	8	241	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02193	heptsyl_trn_I	2.11e-48	4	297	1	290	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
TIGR02195	heptsyl_trn_II	1.82e-43	4	342	1	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43682.1	8.58e-70	3	326	82	405
QSH41947.1	1.48e-67	3	325	10	337
CBK42726.1	3.82e-61	3	341	6	338
QBH13806.1	2.24e-60	6	343	4	348
QOV90040.1	4.06e-59	3	341	11	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	2.02e-26	4	308	2	300	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	2.02e-26	4	308	2	300	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	2.30e-26	4	308	2	300	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
3TOV_A	1.40e-18	3	341	9	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	2.57e-13	4	305	2	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	3.71e-26	4	310	2	302	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	5.67e-22	4	299	2	291	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
Q57336	7.83e-21	3	300	9	294	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P45042	1.06e-20	6	340	4	340	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
Q9R9D5	8.89e-20	14	300	5	289	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000360_03384.