CAZyme Information: MGYG000000362_00847

Basic Information

• Species: CAG-115 sp003531585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp003531585
• CAZyme ID: MGYG000000362_00847
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000000362_8|CGC1	37081.64	4.7451

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000362	2638970	MAG	Sweden	Europe

• Gene Location: Start: 23555; End: 24520 Strand: +

Full Sequence      

MRAVNPNAQPEVQRVLDYLEENRGNRLILGQHTQTMEQPELEHIRRITGKLPALCGFELL
GYSPNIRPEDSSEECMTEVVNARGTLRKAWEWARLGGLITFTWHWFSPLGGRDKSFYSEN
TDFSASRAAQSGTPENAAFLNDLDYMAGLLRPFSDEHIPILWRPFHEAEGSWFWWGREGA
EPCKKLYRLMFERFTERHRLDNLIWVQNSPKIENYPGDDVVDIISRDLYPPAHEHTDLAM
EYAEISSSISTEKLAAVAEIGTIPDVPALIEHRVPWSWFMTWSGSFTTSENFTSYDELRR
AYSCENAVTLDKLPELYECRL

Enzyme Prediction     

No EC number prediction in MGYG000000362_00847.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	4	311	1.6e-93	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.40e-56	4	284	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	4.66e-12	154	229	176	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK45707.1	8.75e-145	5	317	8	321
AIQ66101.1	6.00e-139	5	317	12	325
AOZ93051.1	1.48e-134	5	317	11	324
AIQ67637.1	2.97e-134	5	317	11	324
QTE69139.1	5.39e-134	5	317	9	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	4.19e-65	4	313	7	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	1.24e-61	5	313	147	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.87e-50	4	314	35	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	7.94e-43	8	282	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	3.69e-36	1	313	21	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.20e-60	5	313	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	2.63e-54	2	313	27	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.36e-53	8	315	151	459	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.89e-51	4	311	29	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	3.49e-46	4	314	157	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000362_00847.