CAZyme Information: MGYG000000362_02074

Basic Information

• Species: CAG-115 sp003531585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp003531585
• CAZyme ID: MGYG000000362_02074
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		44351.98	4.7775

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000362	2638970	MAG	Sweden	Europe

• Gene Location: Start: 12202; End: 13341 Strand: -

Full Sequence      

MTDYRTDFEALEKRLAERPADPGKLVTDDPTPNTLRLWEFLKSCYGKKYISGQQYLWEDE
KEDLVYYNTTGKIPAIRGYDFMGISGLARGYDQLGRAIDWARRTGGILTMCWHWNAPDDM
NDIGGLSSFYYKTTNYDRKTGFDIVRAMQEGTPEHDFIIYEIDLVGSALKMFEQQDIPVI
WRPLHEAAGNWFWWGNRAPAGQQDPESVAAYKKLWYTIFDRLMNYHKLRNLIWVWNGQAP
FMAVSPNTFDIAGEDIYDEIPNHGSQLERFKAVSSYTHGKMITLSECGSIPDPDEMQKDG
SNWLWWLPWWGTFVYDTDGEWKPILDENDMPRPNPKYMDEEFLKRVFSDPRVITLEDLPW
YDKDSKPLPNALHHRLNKC

Enzyme Prediction     

No EC number prediction in MGYG000000362_02074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	26	356	1.7e-82	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.50e-38	26	311	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	2.80e-07	112	241	138	235	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK96404.1	7.46e-159	23	378	9	358
CBL34792.1	1.50e-158	23	378	9	358
CBK96003.1	3.74e-100	4	372	70	435
CBL34396.1	7.46e-100	4	372	70	435
ACX63523.1	1.59e-74	25	359	15	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	7.99e-52	7	359	27	357	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6HPF_A	3.34e-49	50	358	32	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	4.68e-44	26	359	35	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	5.04e-44	33	368	153	458	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6Q75_A	3.21e-27	26	309	24	299	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	1.47e-48	7	359	127	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.35e-48	31	355	34	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
G2Q4H7	2.13e-47	37	362	186	481	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	2.33e-45	50	358	54	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55297	4.50e-44	25	365	158	468	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000362_02074.