CAZyme Information: MGYG000000363_01767

Basic Information

• Species: Zag1 sp001917115
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp001917115
• CAZyme ID: MGYG000000363_01767
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42370.64	9.5484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000363	2012818	MAG	Sweden	Europe

• Gene Location: Start: 59225; End: 60349 Strand: +

Full Sequence      

MKKLFIVTGEYSGDIHASHVVKALKTLNPDIEIEGVGGENLRNAGVKLFSDQKKMGAVGL
TPKIVLDHFTLGKRIVDYLVKEFKPDAVLLIDYGVFNLNISKFLKKAGIKVFYYIPPQVW
ASRKWRINTIKKNIDEVLCIFPFEKEMYESYGIKTHYCGHPLVSQLPEKADKDDFFEKHG
LDKNKKLVSIFPGSRVFELKNLMSVFIKTAEELNKKHPDLQFCISHAPNLSDDVYDKYLK
KTNFKVIKGENQALLSVSDALILASGTVALEAALYQTPMIIAYRGPYLFYLIYLIVRCIK
RVSLPNIIADKSIVPEILQSKVTVSNISYQIEKLLYDKDYRENNIEQLGKVKALLSDKVS
SQEAAKVIADALKV

Enzyme Prediction     

No EC number prediction in MGYG000000363_01767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	354	9.9e-108	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.68e-118	1	373	1	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.10e-103	1	373	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.35e-77	4	355	1	359	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.00e-68	6	369	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.17e-49	1	354	1	328	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	2.67e-226	1	372	1	372
QMU61387.1	4.49e-79	4	370	13	382
ABG58662.1	4.45e-77	3	373	2	368
AEG01383.1	2.80e-76	9	373	15	382
VEH64871.1	9.07e-76	3	373	2	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.50e-48	6	335	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.23e-47	6	335	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZVR9	5.81e-74	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q5WWX7	3.24e-73	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1
Q5X5J5	2.01e-71	3	356	6	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Paris) OX=297246 GN=lpxB1 PE=3 SV=1
B6J161	1.78e-70	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	2.51e-70	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000363_01767.