CAZyme Information: MGYG000000364_00084

Basic Information

• Species: Coprococcus sp900767685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus sp900767685
• CAZyme ID: MGYG000000364_00084
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		39768.15	4.7414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000364	3039243	MAG	Sweden	Europe

• Gene Location: Start: 108877; End: 109920 Strand: +

Full Sequence      

MKKQMKVTLIVIVAAIIVAAAIYIVRYIKSGNDLLTPVGTRAEFVGDTDKYPSMLSTKGV
QIVNAEGEQVVLKGVMVPESHRLYDEKKFDEDFYKKVFDMGGNVIRVPVDPAEYKNDDYY
MWRYLDRIVTWAGENGKYVIIDWDYTGNPIDGSGDEMPDISENPLDYSAEFWKNTAEYFK
NTPNVIFEIYNEPVGMSDSEWKRCADSLIGVIRDAGAKQLIIVGSPDYCYDLRWLDELGE
TNNNTAFAVHVYPDKVFWQKFISGYVTSYPIIVTEWGYTDDDVKAKNEKLKGTRNVFGIK
FSSYLKKHNIGWVASSYDYKTEPSMFIKAYKNKTKWGEFVAELLSEE

Enzyme Prediction     

No EC number prediction in MGYG000000364_00084.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	61	334	1.4e-41	0.8981818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.53e-35	63	320	1	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.28e-08	91	335	76	348	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83512.1	2.46e-216	1	347	1	348
QTA37905.1	3.44e-94	29	346	30	351
AEW47956.1	1.22e-74	51	340	55	346
AZR73456.1	3.19e-56	139	344	1	208
QJW90914.1	1.49e-32	55	344	28	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HTY_A	2.89e-28	54	326	51	335	CrystalStructure of a metagenome-derived cellulase Cel5A [uncultured bacterium],4HU0_A Crystal Structure of a metagenome-derived cellulase Cel5A in complex with cellotetraose [uncultured bacterium]
3PZT_A	7.80e-21	28	334	15	305	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
5WH8_A	6.75e-14	55	346	14	309	CellulaseCel5C_n [uncultured organism]
5ECU_A	1.48e-13	47	324	5	299	Theunliganded structure of Caldicellulosiruptor saccharolyticus GH5 [Caldicellulosiruptor saccharolyticus]
6GJF_A	1.90e-13	55	324	13	271	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07983	1.17e-19	55	334	42	310	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	3.90e-19	55	334	42	310	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	2.35e-18	55	334	42	310	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P22541	5.71e-15	50	282	111	341	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
O85465	2.62e-11	55	346	38	328	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985176	0.014289	0.000208	0.000078	0.000044	0.000226

TMHMM  Annotations     

start	end
7	25