CAZyme Information: MGYG000000364_01887

Basic Information

• Species: Coprococcus sp900767685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus sp900767685
• CAZyme ID: MGYG000000364_01887
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281		33099.03	4.2315

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000364	3039243	MAG	Sweden	Europe

• Gene Location: Start: 78749; End: 79594 Strand: +

Full Sequence      

MYGQRIRYISEVLGCIICSNVYWCMFFVKANQAKEFEKNDYGVFLNADASSLERFKMYET
IVIDAQYFTKRDIELLHQNGTVVYTYLNIGSIENFREYYTTYAELAIGEYEHWEEEEWVD
VANPDWQKFIGQLSQELYEKGVDGFFIDNCDVYYYNPHESIFEGITAILQNIMTFGKAVI
INGGDTYVAEYRERYGAIDQIMTGVNQESVWSSIDFDSGTFGEQTSETRDYFCKYLETCK
ADGVEVYLLEYTTNQKLIRKIKEYCKEQDFHFYISNSLELR

Enzyme Prediction     

No EC number prediction in MGYG000000364_01887.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	60	277	5.9e-58	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2342	COG2342	4.76e-10	27	274	12	277	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
COG3868	COG3868	6.53e-10	58	278	80	301	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	1.73e-07	62	153	21	112	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
cd06592	GH31_NET37	0.003	119	192	120	191	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08521.1	1.44e-102	37	280	39	282
VCV23723.1	2.90e-102	37	280	39	282
CBL11057.1	2.90e-102	37	280	39	282
AOZ95737.1	8.02e-88	37	281	41	286
QHI71547.1	2.70e-85	12	280	10	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993645	0.004253	0.001973	0.000028	0.000016	0.000103

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000364_01887.