CAZyme Information: MGYG000000366_01729

Basic Information

• Species: UMGS882 sp900757905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS882; UMGS882 sp900757905
• CAZyme ID: MGYG000000366_01729
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		44578.66	5.0502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000366	2815847	MAG	Sweden	Europe

• Gene Location: Start: 47654; End: 48835 Strand: -

Full Sequence      

MAEKMKLGLVGLGQRGSSLLEGIFIPSERVEVAAVCDIYDDRIEKAVSRVTEAGQKAPFA
TKDYRELIDKDKVDLVVIASPWKEHVPMVLYALEQGIPCGSEVGGAENLEECLSLVDTWE
RTLTPYMFLENCCYGRREMMVLNMVKKGVFGEIVHCSGGYRHDLRTEVGYGRENRHYRLD
EYLTRNCENYPTHELGPIAQVLDINRGNRFLSLTATASKAAGMHDYILRHKPEDETLKNA
VFSQGDVVTTVIKCARGETVTLTLDTTLPRFYSRDFRVQGTKGLYEEATDSVYLDGMGEY
WNWKPNWGNAAEFVEKYEHEVWKKYIAEGVQGGHDGMDYLVYNEFFDCVRENRTMPIDVY
DAAAWMSITPLSEKSISDGSMPVAVPDFCKKRK

Enzyme Prediction     

No EC number prediction in MGYG000000366_01729.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	390	3.2e-146	0.974937343358396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.69e-18	4	387	3	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.29e-07	5	122	1	112	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG1712	COG1712	1.01e-04	5	99	1	87	Predicted dinucleotide-utilizing enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH43530.1	9.38e-170	1	392	1	394
ALS29040.1	1.18e-166	1	388	1	390
QIB57148.1	3.73e-166	3	388	2	384
QMW80076.1	3.73e-166	3	388	2	384
QBE96673.1	7.50e-166	3	388	2	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.07e-95	3	388	19	426	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	4.71e-78	4	390	42	435	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	2.43e-07	3	157	4	150	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6LB54	9.99e-96	4	390	49	454	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8F7	5.88e-95	3	388	19	426	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	8.85e-94	3	388	32	436	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	7.45e-93	5	390	53	456	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
Q01S58	1.54e-87	5	390	43	429	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000366_01729.