CAZyme Information: MGYG000000367_01066

Basic Information

• Species: QAKD01 sp003343965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; QAKD01; QAKD01 sp003343965
• CAZyme ID: MGYG000000367_01066
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000000367_25|CGC1	37034.46	3.9641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000367	1764233	MAG	Sweden	Europe

• Gene Location: Start: 12293; End: 13279 Strand: -

Full Sequence      

MNEKETIIVNGYAYPSIDPDSLASWLPSLTLLSNFSYGFTPEGDIIDLDDENLIRAAQEA
GGVGNLMVLTPLDSEGVFSNELARQLLENPAARENLIDNIINVLYEKELFGVDFDFEYVL
AENRDQYTALVAEATERCNQAGFIVTVALAPKTSRDQPGLLYQGHDYFGMGQAANFVLLM
TYEWGYTYGPPLPVAPLPSVRRVLDYGVSEIPPDKILMGMPNYGYDWTLPFVQGESRAEK
ISNGEAVARAARYGVAIEYNEEYQSPYYYYYDEENREHVVWFEDERSWQAKFNLVSEYGF
AGISIWNIMPPFEGGRAILESDFNILKV

Enzyme Prediction     

No EC number prediction in MGYG000000367_01066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	83	308	3e-42	0.6993243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.62e-119	9	315	4	309	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.62e-91	4	306	99	405	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	6.97e-30	85	308	84	331	Glyco_18 domain.
cd06549	GH18_trifunctional	3.26e-29	40	306	36	288	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	5.52e-25	86	308	82	304	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX63466.1	3.07e-143	6	328	13	334
QIB68537.1	2.07e-139	5	328	2	336
QAT42169.1	3.93e-137	5	328	2	336
QHI71782.1	3.02e-134	5	309	2	317
QHQ61716.1	4.33e-118	7	328	107	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	5.06e-75	29	327	135	431	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	1.14e-65	15	308	19	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	1.24e-64	27	327	131	429	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4WIW_A	5.76e-26	47	306	56	327	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
5JH8_A	8.07e-23	72	306	70	297	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.30e-70	27	327	129	427	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	2.37e-68	15	328	111	420	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	4.48e-64	27	327	130	428	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	6.30e-64	27	327	130	428	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O32258	2.25e-27	20	306	43	326	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000367_01066.