CAZyme Information: MGYG000000368_01458

Basic Information

• Species: F23-B02 sp004553495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp004553495
• CAZyme ID: MGYG000000368_01458
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		65147.34	7.2384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000368	1707423	MAG	Sweden	Europe

• Gene Location: Start: 4675; End: 6417 Strand: +

Full Sequence      

MRASYIFPVLIIMFIALFYIACPSPDGARLMGKNPAFGRKDALALGVIMLLYSAAAFWGL
GDTSAPESFHRFESGERAVIDLGQVQEVEGLTLYPGLNTGSYRIEYSADGVNWRDGASFE
QNYVSLFKWADVGFADGVVPARYIRLTAAGDVWLGELAVNSAEGHIAASSQASELADEQA
LIPDATSYLNSTYFDEIYHARTAFENLEGIYPYEVSHPPLGKLIIAIGIQLFGMTPFGWR
FSGTLFGVLMLPAMYVLIKRLFGSSQTAACGAAIFAFDFMHFSQTRLATIDTYAVFFILL
MYLFMYAYITTDKTRHFALSGLFFGIGAACKWTCIYAGAGLAVIWLIYQLRHFDIKHFAK
SSASGVLFFILVPAVIYYASYYPYGQASGLHGIGMYFTSDYANIVLDNQKFMFTYHSGVN
AEHPYSSRWWQWIINERPILYYLNYFDDGTRSSFGAFLNPVVCWGGLGAMVICAVYSIRR
RDNASLFIVVGYLSQLLPWVFITRTTFEYHYFPSSVFLVLAICRVLSLIRCNTRNWRFSV
YGLTALSCALFVMFYPVLSGMRVNSQIATNLLKWLPNWPF

Enzyme Prediction     

No EC number prediction in MGYG000000368_01458.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	188	384	1.1e-51	0.9237668161434978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	1.77e-24	409	576	7	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	6.98e-18	187	383	16	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.09e-16	216	377	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4346	COG4346	1.93e-15	205	444	126	332	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	2.31e-15	186	382	42	265	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	1.00e-171	23	580	44	653
QQR07704.1	1.00e-171	23	580	44	653
QIA32159.1	3.21e-169	23	580	40	649
QBB67038.1	4.47e-158	39	580	74	752
ALP95330.1	8.93e-158	39	580	74	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	1.42e-27	194	578	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.42e-27	194	578	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	3.29e-27	194	578	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	5.35e-19	215	578	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
O67270	8.54e-07	191	371	31	212	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988299	0.007565	0.003994	0.000036	0.000019	0.000081

TMHMM  Annotations     

start	end
5	22
42	61
236	258
287	309
324	346
358	380
456	478
485	502
507	529
536	558