CAZyme Information: MGYG000000369_00715

Basic Information

• Species: CAG-170 sp003516765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-170; CAG-170 sp003516765
• CAZyme ID: MGYG000000369_00715
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		44567.21	10.0666

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000369	1959873	MAG	Sweden	Europe

• Gene Location: Start: 84027; End: 85253 Strand: -

Full Sequence      

MQQVISGAMLALKLVSAYFLIVALFALKKPKPIPRANPKMRFACVIAARNEERVIGALVQ
SLLQQNYPKMLFDIYVMPNNCTDHTALAAIRAGAGILKPRSEVRCKGDALHEAFETLLRK
DYDAFCVFDADNVVDADFLSRMNDAFLAGAKVTKGAMRVKNPQDGPLCGSYGLYFTCFDF
FFSRARMNCGLSSKLVGTGFAVHRSVLEQSGGWNSATIAEDAEFAAYLAETGTRVWFVPE
AVTYDEAPTSVRVSLRQRRRWSSGIMDVAQARAGALARSAFAGGGMRALDMLAMLTQPFC
QAAGFLLTCAFALSQTGWKRALALLPLGLLGGYLAMSAFALLLAAISKQKTALRAVLLFP
LFMASWLPLNLVSLLFRTRVWKEIEHGKTVHPALPAASLRRVRSGISD

Enzyme Prediction     

No EC number prediction in MGYG000000369_00715.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	41	262	1.2e-27	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	2.93e-56	45	224	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	8.68e-39	14	378	27	407	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.12e-36	45	221	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06439	CESA_like_1	3.10e-21	18	266	5	249	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
pfam13641	Glyco_tranf_2_3	3.62e-20	41	264	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ39935.1	2.90e-112	12	397	15	409
BCI60981.1	4.39e-71	18	388	25	406
QOX65217.1	7.07e-69	18	408	29	427
ADO38773.1	1.96e-68	18	390	22	405
ARD65366.1	1.96e-68	18	390	22	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	9.92e-06	45	140	18	111	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	7.25e-22	33	264	38	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	8.92e-16	38	264	106	335	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	1.19e-12	45	264	111	333	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	3.76e-12	45	264	111	333	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q6L538	1.77e-07	50	268	240	469	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
292	314
321	343
353	375