CAZyme Information: MGYG000000373_00140

Basic Information

• Species: UMGS1537 sp900761045
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900761045
• CAZyme ID: MGYG000000373_00140
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	MGYG000000373_4|CGC1	96320.56	5.4659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000373	2809464	MAG	Sweden	Europe

• Gene Location: Start: 23758; End: 26322 Strand: -

Full Sequence      

MKNKNSEKKRNRSQRLGLAVLAVTALLMLTFSACSEGGSTELENSGFESGSGASIDGWSQ
YNYKKDYEGNTDCTQITLTSMEFSGQCVRIVSQDQNDARIYQEIQVQPESNYCVKFDTLY
ENIDADVPETERGAGLNVSVKDGLERSGSLYGSVSEWQTVTVYFKTVADQKSVELTIGIG
GYGAESSGTAYIDNVRIEKVDSVPEGEVAFSAAVSSSGGQDAPSASIWMKLLFLLLAGGV
IAFVIVVSLKADKENAAKNNPLSQKNPLLNKKDFIILIVLVVVCSVMSFYKLGNAYAASS
YWKASEAGEYVIVEFDQTETVARTVYSNNIPANNNAVSYTVYYETEDGSGEYESVFSIKA
GAFFEWEHVDSSFTTRRVKIVSTRSGLGVNEMGFFRKNDSGEYEKLNVTVAETSYNKELN
ENHNPAMLFDEQDTVEPYSSYMSSTYFDEIYFPRTAYEHIHGYPVYEITHPPMGKILMSI
GIRIFGMNPFGWRFMGTLFGVALVPLMYLLGLKLFKKRIYAFTAAFLMMFDFMRLAQTRL
ATIDSYSAFFILCMYYFMYDYFTQKSYEKKPFWKSLLPLLFCGIMFGLGASTKWVCLYAG
VGLAFLFFLAKYLEADDIASGRALPANKEKSWFTHNFIPTCCACVVFFIVIPAAIYILSY
IPYMAPSPDKSLIDIVLDNQTYMFNYHSGLTEGHPYGSAWYTWPINMRPIYYYSGSNANL
AEGMSTSIVSMGNPLIWWTGLACIFPAAFYAWKKRDKGILVAFVGYAAQFLPWILVTRVA
FIYHYFTAVPFMIFMIVYVIKNLIEDGVISKHVLWIYLALVLVLFIMFYPVLTGREVSRS
YIDNFLRWFSTWSF

Enzyme Prediction     

No EC number prediction in MGYG000000373_00140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	442	663	6.6e-56	0.9192825112107623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	8.41e-28	683	850	10	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	1.41e-22	683	854	508	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	6.49e-18	444	658	20	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	2.25e-14	441	609	51	193	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
COG4346	COG4346	2.92e-13	458	713	126	330	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV69574.1	1.51e-161	13	848	2	860
ABN54290.1	1.07e-154	42	854	32	968
ADU73726.1	1.51e-154	42	854	32	968
ANV75398.1	1.51e-154	42	854	32	968
ALX07656.1	1.51e-154	42	854	32	968

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	1.96e-32	447	852	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.96e-32	447	852	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	1.21e-27	447	852	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.72e-23	468	852	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
O67270	4.05e-08	464	577	49	164	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000081	0.004969	0.994990	0.000014	0.000005	0.000002

TMHMM  Annotations     

start	end
16	33
227	249
274	296
490	512
519	536
540	559
572	589
594	613
636	658
735	752
759	776
781	800
813	832