CAZyme Information: MGYG000000373_00308

Basic Information

• Species: UMGS1537 sp900761045
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900761045
• CAZyme ID: MGYG000000373_00308
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	MGYG000000373_10|CGC2	65005.91	5.0342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000373	2809464	MAG	Sweden	Europe

• Gene Location: Start: 12554; End: 14278 Strand: +

Full Sequence      

MSEQNECLNKVPYGIRDESIFRNTEEDKRVRRFMTPKRILWMTQTDKAEVTGAETLLKPH
VKQIHFNVPEQCRLESKGKSAGILLDFGVEFHGYVKLYIHSVSPQRVRLRIRFGESASEA
MAELGGEKNATNDHINRDQIIDVGFLSMPEIGPSGFRFVRIDVVDPEAMITLQAVQGIFV
YRELEYKGSFECNDELVNKIWNTAAYTVHLNMQEYVWDGIKRDRLVWIGDIHPETSTIQA
VFGYDESVERSLDLARDESPLPNMMCGMSAYSLWWIMVQYGWYMQNGNRTFLESQKEYLV
ELLRYFAGCIKENGSEDLPENRFVDWPTADKPDVIHAGLQGIMRMAFQAGEFLCAELGDS
ETAKLCRDAFEKLGRHIPEHYANKQAAALLVLAGLADPVKTTNLILKRGGARGFSTFMGY
YMLCAIGEAGDLAAALNILREYWGAMLSRGATTFWEDFNMEWLEGSSRIDELVAEGEKDL
HGDYGAYCYQGFRHSLCHGWASGPAAFLSQYVLGVRPAAPGCEKVTIRPNLGDLEWVKGT
YPTPYGIIRVEHRRKEDGTLESQIDLPEGVTLAE

Enzyme Prediction     

No EC number prediction in MGYG000000373_00308.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	80	571	5.2e-102	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.30e-15	188	512	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.72e-12	514	571	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFC30266.1	1.47e-212	26	572	12	562
AEI41762.1	1.47e-212	26	572	12	562
QEM11316.1	4.33e-212	30	572	40	584
QMV41231.1	8.75e-210	25	572	6	555
QTF59433.1	2.31e-209	30	574	40	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.76e-46	69	550	180	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.10e-15	76	513	90	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6GSZ_A	2.26e-11	80	547	325	811	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.83e-08	59	567	363	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000373_00308.