CAZyme Information: MGYG000000374_00265

Basic Information

• Species: CAG-631 sp900762575
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-631; CAG-631; CAG-631 sp900762575
• CAZyme ID: MGYG000000374_00265
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		56319.97	6.1888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000374	1601144	MAG	Sweden	Europe

• Gene Location: Start: 1148; End: 2593 Strand: -

Full Sequence      

MKRINRIFKRKIVMVASEVEPFAKTGGLGDVLGALPKALSENNCNVIVVMPKYQQINEKY
CQQMEFLGYIYVDLNWRHQYCGIFKLIKDNVTYYFLDNEFYFKHEKLYDDLDLEKFSFLD
VALFEVLKYIDFKPDIIHAHDWQTGVVPALLKLRYQKDNFFKKTKCVYTIHNLQYQGKFD
KNQVLDILPLASDDYRGEVNFMKMGIIYSDKITTVSPTYMEEIKTPQYGEGLNQMLSDYY
YKLEGILNGIDYNVYNPAIDKFIDVNYDDKNYVNYKKINKLNLLTDLNLNKNIDIPLIGI
ITRLASQKGIDLIIQIMDELLSKDVNVILLGSGEQYYENIFRYFQNQYPNKFVAVLKFDN
ALAHKIYAASDLFLMPSLFEPCGLVQMICLKYATLPIVHETGGLKDSIKSYNEFEQTGNG
FSFSVYSRNDFMFTINRALNFYYRPEEFNKIIKNALDCDFSWTNSSKKYILLYDGLIEVK
E

Enzyme Prediction     

No EC number prediction in MGYG000000374_00265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	11	474	2.7e-176	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	11	473	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	11	477	2	464	glycogen synthase GlgA.
TIGR02095	glgA	2.78e-172	11	476	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	1.31e-160	11	477	2	479	Glycogen synthase [Carbohydrate transport and metabolism].
pfam08323	Glyco_transf_5	1.08e-95	12	237	1	238	Starch synthase catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO19214.1	5.94e-166	11	477	3	476
AEV67748.1	1.02e-157	9	477	3	478
QGT51026.1	1.84e-157	10	477	3	477
SLK22888.1	2.11e-156	11	480	2	478
QBJ76453.1	2.11e-156	11	480	2	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	2.48e-76	12	473	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	2.58e-72	10	474	125	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	2.28e-71	11	473	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.90e-71	11	473	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.97e-70	11	473	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2V049	1.03e-152	11	476	2	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	3.34e-151	11	476	2	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
A4J4I4	1.01e-150	11	477	2	475	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
A6M334	1.28e-148	11	476	2	475	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
Q8XPA1	2.84e-148	11	478	8	482	Glycogen synthase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000374_00265.