CAZyme Information: MGYG000000376_00550

Basic Information

• Lineage: Bacteria; Patescibacteria; Saccharimonadia; Saccharimonadales; Saccharimonadaceae; UBA1103
• CAZyme ID: MGYG000000376_00550
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		28156.4	4.8915

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000376	685078	MAG	Sweden	Europe

• Gene Location: Start: 152; End: 862 Strand: +

Full Sequence      

MLAEGWEKMLGWRSPNYVYQPNNTSRTRLLLKNYRLSDDIAFRFGDRTWKEYPLTADKYV
EWIDEDKDSPLTNIFIDYETFGEHQWADTGIFEFLRSLPKEWLKDKDHKFMTISQAAEAY
APADSLDVPYTTTWADSERDLSAWLGNRMQQESQHYLYSLAPAIMATEDVNLIGDWRRLT
TSDHPYYMSTKYWNDGDVHAYFSPYKSPYDAFLCYMNALRDIRYRLIEHQEHTRIN

Enzyme Prediction     

EC	3.2.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	13	157	1.6e-23	0.37597911227154046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10795	GH57N_MJA1_like	3.29e-76	1	147	163	306	N-terminal catalytic domain of a thermoactive alpha-amylase from Methanococcus jannaschii and similar proteins; glycoside hydrolase family 57 (GH57). The subfamily is represented by a thermostable alpha-amylase (MJA1, EC 3.2.1.1) encoded from the hyperthermophilic archaeon Methanococcus jannaschii locus, M J1611. MJA1 has a broad pH optimum 5.0-8.0. It exhibits extremely thermophilic alpha-amylase activity that catalyzes the hydrolysis of large sugar polymers with alpha-l,6 and alpha-l,4 linkages, and yields products including glucose polymers of 1-7 units. MJ1611 also encodes another alpha-amylase with catalytic features distinct from MJA1, which belongs to glycoside hydrolase family 13 (GH-13), and is not included here. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.
COG1449	COG1449	1.05e-42	1	224	269	500	Alpha-amylase/alpha-mannosidase, GH57 family [Carbohydrate transport and metabolism].
pfam03065	Glyco_hydro_57	3.42e-25	1	129	169	293	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
cd01022	GH57N_like	1.52e-12	11	146	175	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGL62675.1	1.20e-112	1	235	171	405
QUB37932.1	2.64e-107	1	232	172	405
QHU91263.1	5.22e-102	1	231	172	404
AHB42593.1	2.17e-101	1	227	172	399
AKM80022.1	3.17e-101	1	228	173	401

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59006	4.26e-59	1	228	164	398	Putative alpha-amylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1611 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000376_00550.