CAZyme Information: MGYG000000378_00619

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000378_00619
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579	MGYG000000378_8|CGC3	65272.02	6.6944

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000378	2604862	MAG	Sweden	Europe

• Gene Location: Start: 49644; End: 51383 Strand: -

Full Sequence      

MKGKDLIARATAYGKEYGTGRLVRKTLEHEKIRKAEAGYERWLSAHLPSQGKLERQRKES
ENQEGPLISVLVPIYRTPERFLREMIESVLQQSYPHLELCLADGSGDDTAAETVIREYAE
KDARVRYAHLPANGGISGNTNAALQMAEGEFVCLLDHDDLLAPDALYELAALLRKDPALD
AVYSDEDKVDFEGKQHFQPHFKPDFNLDLLRSNNYICHLFCVRTVLARKTGGFRRAYDGA
QDYDFILRCTELAGKIGHVSRILYHWRCHQASTAANPDSKRYAYEAGKRAIEAHLERCHV
RGLVAYTDNPGFYRVRYALPRTPRVQAVIPGEFSHAERRWLEARLQAATAYPDFHVCVGR
EAEGLIEALAAGSREPEGFVLFLNPSVYPMNRGWLRELVSHGLRTDAGCVTGRIYDEKHH
LLHAGEVTGMFGLAAACPFKGTRSGFYGYMHKIGLQQDFTVVTGECLLIREEVLAKLLAG
RKLNGSVPGLEEASAESWNLQELDREGWNIELCLKTQLLGLRNIYTPFAVLELRGAEREV
PGYADYLVVHQERWAEALDACDQAYNSNLSLERGSWVCR

Enzyme Prediction     

No EC number prediction in MGYG000000378_00619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	206	3.1e-25	0.8176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	8.48e-108	66	268	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd06433	GT_2_WfgS_like	9.81e-31	79	273	10	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.94e-27	69	221	1	156	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	7.86e-26	70	259	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	6.05e-23	66	319	3	250	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22272.1	6.29e-150	5	572	4	578
CBL21583.1	8.06e-136	29	576	44	606
QIB58022.1	1.15e-135	29	579	40	605
QMW77454.1	1.15e-135	29	579	40	605
QBE99393.1	9.15e-135	29	579	40	605

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.73e-85	25	577	327	896	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.10e-55	37	477	291	755	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	3.12e-17	64	315	6	253	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q57022	3.38e-13	66	273	4	198	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
P71057	2.44e-12	64	294	2	237	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000378_00619.