CAZyme Information: MGYG000000380_00623

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Merdibacter
• CAZyme ID: MGYG000000380_00623
• CAZy Family: GH136
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959	MGYG000000380_73|CGC1	103810.61	4.1055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000380	1622044	MAG	Sweden	Europe

• Gene Location: Start: 1203; End: 4082 Strand: -

Full Sequence      

MDGFPGQYPGNTIYYLDSQAAEGGNGLTEATAFDSLDDINNIQFAAGDQILIKRGSVFLG
QLYPKGSGSEDAPIIIDAYGEGEKPLIDGNGRYSNAPTKNDDGPFGEAGSAVYLCNQQYW
EINNLRVRNWSDDNVDKERSGIRVEAYGGGTYHHIHIKNCEIADIRGYNGQDSIWDVAPE
NGGTTFYGARTTHRTGGINIISYTKRDTSVPLGEAEAILDDQPTIFDDVRIEDNTIENCH
ANGITTHNIRGELDDKSYRHTNVVIRGNEIRNVQRAGIVPLYTSGALVEHNLVDTFQQTY
AGYGCGIWCDRADGMIFQYNEVCNGRNTMDGMAFNLDDMTENGIIQYNYTHNNVGGGYML
HVRTNSYNRNNIIRYNLSVNDTAGFAAHQAIIVCVGEDANTKIQNAKVYNNTFVNNNVVH
PVYQGDQIAFTNNIFYLTNEGMRTQNGAYTVGANTTFKNNVFAGVHPAGEPTGNGNISVD
EAVLAGTFYGSESLTDAMEMAKLCHDSAALNAGDAQLIAEEQIAEDFYGNPAGGESVNAG
IYNGASIDPLPDQGDPGTENPGIDEEPSEEDYNVEYVEAESDVVEKSEGYTLASGAAMSQ
GHANTHIYYSNTGTYVEYTFTGKAISVYTKTGPGAGTIDIYVDGEQVGVDDQYNPVQTFN
KRAYTIVFEEEGEHTIRLESNGTKNPSSTGYSFNIDCFKVFHEKEANADLAALSYRIDGG
TITAIDGFDPAQTDYEVLLPIHTSGTIELIAEAAGEHASVESTPIPLTDGEAILQAEVIA
ENGDVKTYIVHFTSAKDDNTALKELHYQLGDGAIVPVTLEEGATEQQITLPKNSSGEIQI
DAEAVCAEAEVRVEPVTLIDGKATAVITVIAEDGSEQVYRIYFVSETEVPQEPVDPTPPE
EEPNLPQETPKPDTETDDKKEPEQDVPTAAAAAGALFTAMTITSGGALLVLKKKKGKQS

Enzyme Prediction     

No EC number prediction in MGYG000000380_00623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	12	534	3.3e-97	0.9775967413441955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04079	CBM6_agarase-like	4.15e-07	576	698	5	130	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.
pfam13229	Beta_helix	4.64e-07	227	376	9	137	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam17996	CE2_N	3.19e-06	612	678	18	80	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam12733	Cadherin-like	0.002	722	793	4	87	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE35145.1	6.50e-176	10	713	34	762
AZG68471.1	5.02e-119	14	440	118	560
QJD84649.1	2.95e-61	12	547	255	739
QNK55089.1	5.68e-61	12	547	254	740
QNK55088.1	5.58e-59	12	548	58	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V6M_A	5.09e-32	10	534	8	568	ChainA, Fibronectin type III domain-containing protein [Tyzzerella nexilis]
6KQT_A	1.63e-25	14	384	247	620	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - native protein [Eubacterium ramulus ATCC 29099]
6KQS_A	2.68e-24	14	356	247	595	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - selenomethionine derivative [Eubacterium ramulus ATCC 29099]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
929	951