CAZyme Information: MGYG000000382_00002

Basic Information

• Species: CAG-269 sp900554175
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp900554175
• CAZyme ID: MGYG000000382_00002
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
186	MGYG000000382_1|CGC1	21626.19	5.4535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000382	1513268	MAG	Sweden	Europe

• Gene Location: Start: 1337; End: 1897 Strand: -

Full Sequence      

MTKLLKKIIIFAVLIGIVVSILNYKNIRKQILMKIYIRDYQEYVERYSEEFGVDPNLIYA
IIKAESKFNEEAVSNKEAKGLMQIMYTTALDVAKTLNIEIDEKKLLEPECNIMIGTKYIS
ILLNRYSNIELALAAYNAGSGNVDKWVEKSILLEDGSNVENIPYKETNNYVRKILRDYEI
YKELYN

Enzyme Prediction     

No EC number prediction in MGYG000000382_00002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	43	180	1.7e-29	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.35e-62	40	180	4	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.83e-56	36	184	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.83e-39	55	179	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.07e-34	39	186	138	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	1.09e-33	42	176	1	159	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU68364.1	6.48e-48	11	185	12	188
AIS52076.1	4.04e-45	6	186	3	183
AXU49364.1	7.62e-45	6	185	4	178
AWH80563.1	7.62e-45	6	185	4	178
AWH76797.1	7.62e-45	6	185	4	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	2.07e-20	36	185	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	2.07e-20	36	185	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	2.08e-20	36	185	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.09e-20	36	185	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.10e-20	36	185	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.05e-22	44	178	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.01e-19	36	178	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.01e-19	36	178	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P39434	1.02e-16	40	175	480	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	4.73e-16	40	175	480	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.951011	0.039663	0.007833	0.000089	0.000061	0.001353

TMHMM  Annotations     

start	end
7	24