CAZyme Information: MGYG000000385_00504

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111
• CAZyme ID: MGYG000000385_00504
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000000385_3|CGC1	36366.97	7.7373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000385	1909808	MAG	Sweden	Europe

• Gene Location: Start: 13225; End: 14196 Strand: -

Full Sequence      

MADLKEKLYQMFILGTEGGYLNKALEHGLGGVIFFSKDIQTTEQFKTLVKKIKSTAKITP
LLSIDQEGGRVERTENIHNGKKYLSAKFAFEKGEEFLKTQTEKISQELKSYGINLNFAPC
IDTNTNPNNPIIGERAFSSTPEDVIKAEKIISNIYQKNGIIPCVKHFPGHGDANADSHLT
LPEINLSIDEMEKTHIKPFKAAIENGIDMIMAAHLHCTCFEKDKIPTSLSKNALNYLRNN
LNFKGVIISDDMVMKGVSDFGDVEACEMGIKAGINIFIYRFADKKTFDIIDQIYKKALNN
NELKDNILKSYDKIINLKTKYLL

Enzyme Prediction     

No EC number prediction in MGYG000000385_00504.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	54	277	3.4e-44	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	7.09e-60	4	278	3	278	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	6.41e-58	4	276	2	281	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.39e-42	25	273	21	273	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.50e-05	112	276	150	317	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38577.1	1.21e-171	1	319	1	318
QHE60213.1	1.07e-57	4	321	46	371
QHE52286.1	6.92e-57	3	321	80	407
ARI75869.1	1.99e-56	4	321	68	394
AZU60778.1	5.37e-56	3	321	232	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	2.19e-45	26	320	83	395	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.41e-45	26	320	57	369	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.17e-44	26	320	87	399	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	1.55e-44	4	320	13	339	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	2.95e-40	3	322	8	341	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.20e-44	26	320	83	395	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	8.91e-41	27	320	62	382	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B4RQ67	4.91e-37	23	278	27	287	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=nagZ PE=3 SV=1
Q5FA94	5.19e-35	23	278	27	287	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=nagZ PE=1 SV=1
Q9K0Q4	1.01e-34	23	278	27	287	Beta-hexosaminidase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000385_00504.