CAZyme Information: MGYG000000385_01149

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111
• CAZyme ID: MGYG000000385_01149
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		42379.61	8.4991

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000385	1909808	MAG	Sweden	Europe

• Gene Location: Start: 27521; End: 28648 Strand: -

Full Sequence      

MKKIFIITGEYSGDIHASNVVRELKALNSDVAIEGIGGDNLAAEGVKLFANQDKMSAVGI
SPKILIDHYKLGKSLVDYLKNDFKPDLVLLIDYGAFNLSVAKFLHAAGIKIFYYIPPQVW
ASRKYRIRLIKKFVDKVLCIFPFEKPLYAQYGIDAHYCGHPLVAQLPPAVYRKEFLQKHG
FDPDKKLVSVFPGSRVFELKELMSVFKESVEKLKQKHPDLQFCMSQAPNLSDDVYKKYLG
DDFDIKVIKGENQALLSASDALILASGTVALEACLYKTPMIIAYRGPKLFYWIYLLVRCI
KRVSLPNIIADKEIVPEIIQDKVTPINITYEIEELLYNSEKRSKTIEELANVKSLLSDKN
SALEVAKVIDTELFS

Enzyme Prediction     

No EC number prediction in MGYG000000385_01149.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	2.8e-109	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.55e-128	1	372	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.72e-109	1	369	1	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.02e-80	4	365	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.85e-72	4	359	8	368	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.05e-46	1	370	1	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	5.16e-180	1	375	1	374
AEH45383.1	3.89e-79	3	368	10	371
AKQ33376.1	8.07e-75	2	368	6	371
AFE09254.1	2.50e-72	3	369	8	376
QAT84154.1	2.77e-71	3	369	8	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.33e-46	4	338	9	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.60e-46	4	338	9	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	8.31e-72	2	375	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	1.17e-71	2	375	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
A9NCA7	1.17e-71	2	375	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
Q83DS5	1.17e-71	2	375	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
Q1D393	1.58e-70	3	369	6	374	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000385_01149.