CAZyme Information: MGYG000000387_00437

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000387_00437
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787	MGYG000000387_4|CGC1	90610.89	6.1958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000387	2488147	MAG	Sweden	Europe

• Gene Location: Start: 98195; End: 100558 Strand: -

Full Sequence      

MSDKTFKGAWHCTQFDWGNFPAPETSKHEYTNSIGTRMVLVEAHDYRRGGGDWENHPDAQ
PTHKCFITKPYYIADEPVKQDIFEQFYNETYNKPSDTTNYRGYVLGVSWFEAAEFCKWLS
KKENKLYRLPTEAEWEAAARKSTELNIDRMCDTHIREWCFDWYDAYTDLDQTDPAGPATG
MCKVIRGGYLDNPARYNEHNLDLWWRASLPPTYRHYHDDKNNEFGRHIIGLRIACGELPE
VSDKHPTNQVCMNVHQKGVHLTDGPDPKKPYFRKRYVFPTPPDNSPSEEIRAVGLNHIFR
HHHHSPALTVCPNGDLLYSIYSSYKEYDAEVGIAGTRLRKGCDEWEQPDIFVNPVGVNDH
APNLYTDKDGTIYHFWGWQQLTDSFPFQYIYSTDNGETWSEVQFPFFKDKAERVVRQPIN
SCLRDDDGTFYVAADAAFEPGSVLWRSRDNMKTWENPKGRTAGRHSTFVHLKDGSILAMG
GKNSDIDGYMPQAISKDKGDTWEVSKTPFPMQFSGQRPCIIRLKSGRLFMCGDYQNKKGQ
KPDSIKEWGSYGAYSDDDGKTWTLKKLWGTQKQKKSPHEFGGQSTLGYSVCRQTPDGMIH
IITSNNRPLLHFEFNEEWLISHEGESPADKELMKSSATKIVSDIETFEEHYEDGTLRCKW
SGGIADDGRFLLEGEDIFYYPNGEVMTKGEYHLGKRIGEYVYFDEDGFKVFQWNHTNDGF
DVLTTYYPGSDNIKTRARFKNKKAEGLAQTFGRNKGNVTGEYQFSEGVLISKKDLKKEEP
SPIGEIF

Enzyme Prediction     

No EC number prediction in MGYG000000387_00437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	302	509	5.5e-17	0.6666666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.32e-25	301	608	12	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG1262	YfmG	6.07e-18	19	217	34	304	Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain [Posttranslational modification, protein turnover, chaperones].
pfam03781	FGE-sulfatase	4.88e-15	38	188	5	224	Sulfatase-modifying factor enzyme 1. This domain is found in eukaryotic proteins required for post-translational sulfatase modification (SUMF1). These proteins are associated with the rare disorder multiple sulfatase deficiency (MSD). The protein product of the SUMF1 gene is FGE, formylglycine (FGly),-generating enzyme, which is a sulfatase. Sulfatases are enzymes essential for degradation and remodelling of sulfate esters, and formylglycine (FGly), the key catalytic in the active site, is unique to sulfatases. FGE is localized to the endoplasmic reticulum (ER) and interacts with and modifies the unfolded form of newly synthesized sulfatases. FGE is a single-domain monomer with a surprising paucity of secondary structure that adopts a unique fold which is stabilized by two Ca2+ ions. The effect of all mutations found in MSD patients is explained by the FGE structure, providing a molecular basis for MSD. A redox-active disulfide bond is present in the active site of FGE. An oxidized cysteine residue, possibly cysteine sulfenic acid, has been detected that may allow formulation of a structure-based mechanism for FGly formation from cysteine residues in all sulfatases. In Mycobacteria and Treponema denticola this enzyme functions as an iron(II)-dependent oxidoreductase.
pfam13088	BNR_2	5.92e-14	314	601	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG2849	YwqK	8.61e-07	592	786	33	222	Antitoxin component YwqK of the YwqJK toxin-antitoxin module [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARN56731.1	1.76e-182	32	779	34	939
QHS50523.1	1.49e-125	58	719	87	764
QEE29205.1	1.00e-124	58	719	85	760
QHN03010.1	7.73e-122	58	719	83	744
ARN56721.1	3.14e-79	22	619	26	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MUJ_A	1.41e-07	104	201	146	287	Formylglycinegenerating enzyme bound to copper [Streptomyces coelicolor A3(2)],6MUJ_B Formylglycine generating enzyme bound to copper [Streptomyces coelicolor A3(2)],6MUJ_C Formylglycine generating enzyme bound to copper [Streptomyces coelicolor A3(2)],6MUJ_D Formylglycine generating enzyme bound to copper [Streptomyces coelicolor A3(2)],6MUJ_E Formylglycine generating enzyme bound to copper [Streptomyces coelicolor A3(2)]
2Q17_A	1.62e-07	104	201	173	314	FormylglycineGenerating Enzyme from Streptomyces coelicolor [Streptomyces coelicolor A3(2)],2Q17_B Formylglycine Generating Enzyme from Streptomyces coelicolor [Streptomyces coelicolor A3(2)],2Q17_C Formylglycine Generating Enzyme from Streptomyces coelicolor [Streptomyces coelicolor A3(2)],2Q17_D Formylglycine Generating Enzyme from Streptomyces coelicolor [Streptomyces coelicolor A3(2)],2Q17_E Formylglycine Generating Enzyme from Streptomyces coelicolor [Streptomyces coelicolor A3(2)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7AJA5	5.71e-11	34	188	381	584	Serine/threonine-protein kinase pkn1 OS=Chlamydia pneumoniae OX=83558 GN=pkn1 PE=3 SV=1
Q9F3C7	7.49e-07	104	201	141	282	Formylglycine-generating enzyme OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO7548 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000387_00437.