CAZyme Information: MGYG000000387_00698

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000387_00698
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
819		90796.33	4.256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000387	2488147	MAG	Sweden	Europe

• Gene Location: Start: 27105; End: 29564 Strand: -

Full Sequence      

MKKKLAIVLSAIMAIGVIGSVSFSPAVSVSAEESNSEFENPVYDEATDTTDYDYAYFGMY
PTSEVTGDALTDEIKNADYTNEDGNVNLDFQMAEVNGVKYARMKQANATANAIGNGALRG
LTYTDEAFYQWEDNRTYHYFKYEPVKWRVLEVSGDSLLLMADNAVDCQRYSSNTEKYTWS
DSPMRVWLNGYSQKAANGYTCAGGGFLNTAFSKDEQADIIESDIHTEDNTLWGDNIPGGK
DVQDKVFLLSAAETVNESYGFAPDAMTLSSTRRLQPTDYAFAMGTWLGTYNEYYGNCWWM
LRTSGDYAQKMALIYRTGQVYKEGYYVNTPYYGVVPALRVKASSEYVMTEEEYNKKYPSV
TIVYGDADGDGKVTLTDASAALKAALGIDKADDTLTTTLDVDGNGKLELTDVTYVLKYAL
GIISKFPAEDATTTSSVVAQAVEEAEQTHIKEAEDVEVPEYTHYPASGRVWLAADSIAAQ
HDNNTNLAASSLTVKTRDTLGWGVIFNNYFKDGNYRRFEEGQVIDTQFAKNTTDSAVVIN
NTALSSRSSKSFTAEKNYGALTDGIGQGDYLLISFGHNDEYPQVERYTDPYGDSSTEGSY
KWYLKTKFIDPALEAGATPVLISSVVKRNYVDGVYQPQFHEAYATAMKELSEEYAELGIT
IPYIDLHHKMDALYKTLSDDESKLLHASYDVAEFNDEGQEEMIKLLGATAELKDEREAQA
KAALKLLSVDEVKALVAKAAEEKNSLGVSYINEETSGSYMDNVHFTYAGARYAAKYILEG
LKDANLDLYSLTDEDAVKTLDEINTSASFKESEIYKNVH

Enzyme Prediction     

No EC number prediction in MGYG000000387_00698.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	470	781	3e-37	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	7.05e-36	469	705	2	193	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd14256	Dockerin_I	4.22e-11	364	420	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	3.26e-06	365	418	1	54	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14253	Dockerin	1.12e-04	365	420	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
pfam13472	Lipase_GDSL_2	0.001	536	700	33	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTQ16955.1	1.41e-24	541	687	103	254
QTQ14737.1	4.72e-24	541	687	103	254
AUO20372.1	5.15e-24	501	687	620	773
QTQ11105.1	8.64e-24	541	687	103	254
AEJ18222.1	3.79e-23	541	687	77	228

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	1.10e-16	501	706	28	208	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	3.00e-13	467	706	2	198	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000408	0.998768	0.000245	0.000213	0.000180	0.000155

TMHMM  Annotations     

start	end
7	29