CAZyme Information: MGYG000000387_01380

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000387_01380
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672		76445.85	4.6718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000387	2488147	MAG	Sweden	Europe

• Gene Location: Start: 2170; End: 4188 Strand: -

Full Sequence      

MLTDTSKSKYAKVTPIGSESMEWTDGFWKDAVDKCTSVTVPHLQNMFEAEDISHVLENFR
ICANPDDHRPYDGTVFGDGDFYKWMESAMYAANANKDEKLFAKLEEYVQLIAKVQLPDGY
ISTKQIIDERNGTGGRMKDINEFEVYNMGHLFTAACVYYRITGKDSMLNVAKKAAKWLHG
MYLEAKEKDEVQTAVCPSHYMGLIEMYRTTGDTEFLELAKLAVELRDSVKNGLDDNQDRL
PLKTHKKIVGHAVRSTYLYAGVADLYAEDGDEEYFEMLKRVWRNMVDKKMYITGGIGAIY
NGASPYGYFFAHDLIHQAFGYEYQLPNVTAYNETCASLGLVFWAYRMFLIDPKAEYMDVL
ERAMLNVNLAAVSLDGQSFFYENVLRRTKKLDYRLIWRLRRAKYILSYCCPPNLARTIAE
SGEYAYTTSADTVYLGMYGASKAHVKLDNTEFDLKQSTQYPYDGNIVLTANNITGDNTAK
IAIRVPGWVKSGKIAAEGRTIELTKKCAGTYIIVDISDLASAEIVIDFDMPVRLTTAHPL
VEECVNQVAVERGPLVYCIETPDVEIDTLDSLLISPSTQFTPVSYQIKDRMVTALECELL
CKKKASSDELYETLEFDGFDKVKARFIPYFAWDNRSAEDDGTYDVYAIEDKLDTPDDMEY
DEMRIWLPVAYV

Enzyme Prediction     

No EC number prediction in MGYG000000387_01380.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	22	558	7.5e-164	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.41e-140	20	558	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.74e-108	26	651	21	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	6.23e-04	202	295	419	510	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04791	LanC_SerThrkinase	0.003	158	307	98	262	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC67292.1	6.74e-273	1	671	1	651
AGI38357.1	6.74e-273	1	671	1	651
ANX00320.1	9.56e-273	1	671	1	651
ANW97794.1	1.56e-271	1	671	1	651
QOV18624.1	3.12e-263	1	669	1	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	9.52e-153	2	670	25	697	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	3.20e-101	25	635	20	636	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	7.61e-98	25	635	20	636	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	7.61e-98	13	639	7	618	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
7EXU_A	2.69e-77	24	635	6	647	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.15e-76	24	635	6	647	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000387_01380.