CAZyme Information: MGYG000000390_00120

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000000390_00120
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		36515.17	8.7688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000390	2232010	MAG	Sweden	Europe

• Gene Location: Start: 10824; End: 11831 Strand: -

Full Sequence      

MVGYYPSWASGSGLPPQNVDASLLTHIHYAFANVNANGSLILPHGAIDRNNLQGLVALRG
KNPQLKVLLSVGGWDYSYHFSSVAANAATRTTFAKSAADMVKQYNLDGIDIDWEFPKQQD
KRNFTLLLQAVRAELDDLSRTTGRTYLLSIAAGTGLTNMEVSAVASVLDYIFLMGYDMHG
PWDSYADLNAPLYPAGDVSPQYSISVSGTVASYRSAGVPAKKIVLGMPFYGYRYTTDGSR
NDGLYAPFSAGKSISYKQLAASYLSNPSFKRFLHPRARVPYLFDGTTFITYEDAASIAEK
VTYARAQGLGGVGAWELSQDLNFTLLRSAHRALHS

Enzyme Prediction     

No EC number prediction in MGYG000000390_00120.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	2	322	1.1e-79	0.9324324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	3.32e-111	2	320	3	334	Glyco_18 domain.
cd06548	GH18_chitinase	1.28e-105	2	320	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
pfam00704	Glyco_hydro_18	2.36e-94	2	320	3	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	4.80e-86	1	333	1	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	3.72e-83	2	334	41	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL43287.1	9.65e-114	1	333	30	376
QHI73896.1	2.63e-106	1	333	18	363
BCN31452.1	1.43e-104	1	330	171	513
QEY33675.1	1.67e-102	2	334	172	514
QCI60723.1	4.34e-102	2	335	40	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	2.50e-73	1	325	14	411	ChainA, Glycosyl Hydrolase [Niallia circulans]
5GZU_A	1.01e-63	1	320	28	377	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6BT9_A	1.38e-63	1	320	39	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
5GZT_B	3.82e-63	1	320	279	628	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6KST_A	3.02e-62	1	326	9	363	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	6.78e-70	1	325	46	443	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P32470	1.05e-53	4	335	43	400	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
E9ERT9	9.87e-50	4	320	44	384	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
Q13231	8.97e-49	1	320	24	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q9D7Q1	8.99e-48	16	320	43	361	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999108	0.000910	0.000015	0.000003	0.000002	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000390_00120.