CAZyme Information: MGYG000000390_00384

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000000390_00384
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		39822.56	7.1602

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000390	2232010	MAG	Sweden	Europe

• Gene Location: Start: 4570; End: 5619 Strand: +

Full Sequence      

MDKKRICVLSVQMPFVRGGAELMVGTLTQQLIRRGFDTELVQLPFNCFPLDAQVESTYAW
RLLDLSESNGKKIDLVIATKFPTYLIEHKNKMLWLMHQHRVAYDLYDNKVYGGLKYHDNG
EQYRDIFRQADSQAIATFSHRYAISRNVADRLQTYNHLSAEALYHPPSLAGRYQSAEYGD
YILSVGRLDPIKRNELLIRALPSCSPHLRVKIAGRGQEMERLKDLAAACKVADRVDFLGF
TPDEDLLRLYANAFAVFFAPIDEDYGYITLEAFLSKRPVVTCTDSGGVLEFVRDGETGLV
CDTNPKSIARAVNRLYRSKQLCKQMGENGYDLVKDFNWDHVVDLLTQTL

Enzyme Prediction     

No EC number prediction in MGYG000000390_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	179	326	1.6e-31	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	2.28e-44	5	343	1	359	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	8.69e-36	4	345	1	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.46e-33	181	330	4	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03798	GT4_WlbH-like	3.60e-29	48	343	70	367	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
cd03811	GT4_GT28_WabH-like	1.82e-27	5	312	1	321	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ93302.1	1.56e-112	3	349	2	346
BBI35679.1	1.91e-111	3	349	4	348
CUU50759.1	5.21e-109	1	349	1	348
QES75757.1	5.21e-109	1	349	1	348
ABY34214.1	1.01e-100	5	345	3	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F9F_A	1.03e-10	167	324	11	168	CrystalStructure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A. [Archaeoglobus fulgidus DSM 4304]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	2.92e-14	182	341	211	373	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
A4X1R6	4.25e-12	172	345	274	460	D-inositol 3-phosphate glycosyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) OX=369723 GN=mshA PE=3 SV=1
A0LQY9	5.30e-12	179	343	247	422	D-inositol 3-phosphate glycosyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=mshA PE=3 SV=1
Q2JFV0	1.68e-10	180	338	243	413	D-inositol 3-phosphate glycosyltransferase OS=Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3) OX=106370 GN=mshA PE=3 SV=1
Q7KWM5	3.85e-10	217	335	285	402	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000390_00384.