CAZyme Information: MGYG000000390_01390

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000000390_01390
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		45011.32	5.0624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000390	2232010	MAG	Sweden	Europe

• Gene Location: Start: 4259; End: 5455 Strand: -

Full Sequence      

MQNIRVTTDCNNGAVTVSVRTQGPRDGLTVEMEASFHGRAAGGCSAQICGEYTTAAFTVE
DPQLWTAGVPNLYDIVYRLKKDGRVIDTVTGYFGIRTIELKDGAVCINNKPVFQRLVLDQ
GFYPDGIYTAPTDQDLKRDIELAMATGFNGARLHQKVFEERFLYWADHLGYLVWGEHASW
GLDITTADGISCFLPEWLEILERDYSHPAIVVWCPFNETWDNRGRRQDDNVLKTVYLATK
AADHTRPVIDTSGFYHVITDIYDIHDYEQSTAVFQERYRNLTAGGYYDARSDRQRYGGQP
YCVSEYGGTRWPVQDKGGWGYGKAPKSEQEAAQRICGLTETLLDCAGVCAFCYTQLYDIE
QEQNGLYTYDRAPKFTAETYDRFRAVCAKQAAIEKKGR

Enzyme Prediction     

No EC number prediction in MGYG000000390_01390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	354	5.9e-58	0.3829787234042553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.59e-28	11	248	212	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.12e-18	2	248	185	445	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	5.28e-13	2	96	4	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	1.15e-12	2	248	224	485	beta-galactosidase.
PRK10340	ebgA	7.94e-12	56	262	277	486	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95984.1	1.23e-170	1	396	184	579
ANU54514.1	2.63e-152	11	395	194	582
QQR31538.1	2.63e-152	11	395	194	582
ASB42259.1	2.63e-152	11	395	194	582
AYB42891.1	4.55e-150	1	394	186	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	3.33e-36	1	371	198	565	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6MVF_A	2.93e-13	53	267	234	455	Crystalstructure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_B Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_C Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_D Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_E Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6],6MVF_F Crystal structure of FMN-binding beta-glucuronidase from Facaelibacterium prausnitzii L2-6 [Faecalibacterium prausnitzii L2-6]
6S6Z_A	4.43e-13	56	221	275	443	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.43e-13	56	221	276	444	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6CVM_A	4.23e-12	54	248	289	483	Atomicresolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_B Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_C Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_D Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6X1Q_A 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_B 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_C 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_D 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6LL68	5.86e-15	50	261	278	493	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
P81650	5.84e-14	59	261	294	497	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2
Q03WL0	7.77e-14	16	248	235	479	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1
A7KGA5	1.01e-12	51	248	288	485	Beta-galactosidase OS=Klebsiella pneumoniae OX=573 GN=lacZ PE=3 SV=1
A6TI29	1.01e-12	51	248	288	485	Beta-galactosidase 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=lacZ2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998917	0.000998	0.000097	0.000004	0.000003	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000390_01390.